SitesBLAST
Comparing WP_013134300.1 NCBI__GCF_000092245.1:WP_013134300.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
42% identity, 94% coverage: 20:420/426 of query aligns to 17:421/438 of Q83E11
- KS 21:22 (= KS 24:25) binding
- R26 (= R29) binding
- NSGT 93:96 (= NSGT 92:95) Phosphoenolpyruvate
- R123 (= R122) binding
- D315 (= D316) active site, Proton acceptor
- K342 (= K343) binding
- R346 (= R347) binding
- R387 (= R388) binding
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
42% identity, 94% coverage: 20:420/426 of query aligns to 19:423/440 of 3slhD
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N95 (= N92), R125 (= R122), D317 (= D316), E345 (= E344), H388 (= H387), R389 (= R388), T415 (= T412)
- binding glyphosate: K23 (= K24), G97 (= G94), T98 (= T95), R125 (= R122), Q171 (= Q170), D317 (= D316), E345 (= E344), R348 (= R347), H388 (= H387), R389 (= R388)
- binding shikimate-3-phosphate: S24 (= S25), R28 (= R29), S169 (= S168), Q171 (= Q170), R196 (= R195), D317 (= D316), K344 (= K343)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S25), R28 (= R29), T98 (= T95), Q171 (= Q170), R196 (= R195), D317 (= D316), K344 (= K343)
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
42% identity, 94% coverage: 20:420/426 of query aligns to 19:419/434 of 4egrA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N95 (= N92), R125 (= R122), D313 (= D316), E341 (= E344), H384 (= H387), R385 (= R388), T411 (= T412)
- binding phosphoenolpyruvate: K23 (= K24), G97 (= G94), T98 (= T95), R125 (= R122), D313 (= D316), E341 (= E344), R344 (= R347), R385 (= R388)
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
41% identity, 96% coverage: 20:426/426 of query aligns to 19:440/445 of 2pqcA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N92), R123 (= R122), D321 (= D316), E349 (= E344), H399 (= H387), R400 (= R388), T426 (= T412)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K24), S24 (= S25), R28 (= R29), T96 (= T95), R123 (= R122), S168 (= S168), Q170 (= Q170), D321 (= D316), K348 (= K343), E349 (= E344), R352 (= R347), R400 (= R388)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
41% identity, 96% coverage: 20:426/426 of query aligns to 19:440/445 of 2pqbA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N92), R123 (= R122), D321 (= D316), E349 (= E344), H399 (= H387), R400 (= R388), T426 (= T412)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K24), S24 (= S25), R28 (= R29), A95 (≠ G94), T96 (= T95), R123 (= R122), S168 (= S168), Q170 (= Q170), D321 (= D316), K348 (= K343), E349 (= E344), R352 (= R347), R400 (= R388)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
41% identity, 96% coverage: 20:426/426 of query aligns to 19:440/445 of 2ggaA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N92), R123 (= R122), D321 (= D316), E349 (= E344), H399 (= H387), R400 (= R388), T426 (= T412)
- binding glyphosate: K23 (= K24), A94 (≠ S93), A95 (≠ G94), T96 (= T95), R123 (= R122), D321 (= D316), E349 (= E344), R352 (= R347), R400 (= R388)
- binding shikimate-3-phosphate: S24 (= S25), R28 (= R29), S168 (= S168), A169 (= A169), Q170 (= Q170), R195 (= R195), D321 (= D316), K348 (= K343)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
41% identity, 96% coverage: 20:426/426 of query aligns to 19:440/445 of 2gg6A
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N92), R123 (= R122), D321 (= D316), E349 (= E344), H399 (= H387), R400 (= R388), T426 (= T412)
- binding shikimate-3-phosphate: S24 (= S25), R28 (= R29), T96 (= T95), S168 (= S168), Q170 (= Q170), D321 (= D316), K348 (= K343)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
41% identity, 96% coverage: 20:426/426 of query aligns to 24:445/455 of Q9R4E4
- KS 28:29 (= KS 24:25) binding
- R33 (= R29) binding
- NAAT 98:101 (≠ NSGT 92:95) Phosphoenolpyruvate
- A100 (≠ G94) mutation to G: Confers resistance to glyphosate.
- R128 (= R122) binding
- K353 (= K343) binding
- R357 (= R347) binding
- R405 (= R388) binding
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
38% identity, 95% coverage: 20:424/426 of query aligns to 16:424/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
37% identity, 96% coverage: 17:424/426 of query aligns to 13:424/427 of 1rf6A
- active site: K20 (= K24), S21 (= S25), D47 (= D51), N90 (= N92), D115 (≠ K117), R120 (= R122), D312 (= D316), E340 (= E344), H384 (= H387), R385 (= R388), T412 (= T412)
- binding glyphosate: K20 (= K24), G92 (= G94), T93 (= T95), R120 (= R122), Q168 (= Q170), D312 (= D316), E340 (= E344), R343 (= R347), H384 (= H387), R385 (= R388)
- binding shikimate-3-phosphate: S21 (= S25), R25 (= R29), S166 (= S168), Q168 (= Q170), R193 (= R195), I311 (= I315), D312 (= D316), K339 (= K343)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
37% identity, 96% coverage: 17:424/426 of query aligns to 13:424/427 of 1rf4A
- active site: K20 (= K24), S21 (= S25), D47 (= D51), N90 (= N92), D115 (≠ K117), R120 (= R122), D312 (= D316), E340 (= E344), H384 (= H387), R385 (= R388), T412 (= T412)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K24), S21 (= S25), R25 (= R29), G92 (= G94), T93 (= T95), R120 (= R122), S166 (= S168), A167 (= A169), Q168 (= Q170), R193 (= R195), D312 (= D316), K339 (= K343), E340 (= E344), R343 (= R347), H384 (= H387), R385 (= R388)
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
29% identity, 94% coverage: 19:417/426 of query aligns to 17:417/426 of 3nvsA
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N92), P119 (≠ K117), R124 (= R122), H128 (≠ R126), Q135 (≠ S133), Y142 (≠ G140), E144 (= E142), A247 (= A240), A255 (≠ I249), D314 (vs. gap), E342 (= E344), H386 (= H387), R387 (= R388), K412 (≠ T412)
- binding glyphosate: K22 (= K24), G96 (= G94), R124 (= R122), Q172 (= Q170), D314 (vs. gap), E342 (= E344), R345 (= R347), H386 (= H387), R387 (= R388)
- binding magnesium ion: E123 (≠ S121), Q145 (≠ D143)
- binding shikimate-3-phosphate: K22 (= K24), S23 (= S25), R27 (= R29), T97 (= T95), S170 (= S168), S171 (≠ A169), Q172 (= Q170), S198 (≠ R195), Y201 (vs. gap), D314 (vs. gap), N337 (≠ E339), K341 (= K343)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S25), R27 (= R29), Q172 (= Q170), Y201 (vs. gap), D314 (vs. gap), K341 (= K343)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
29% identity, 94% coverage: 19:417/426 of query aligns to 17:417/426 of Q9KRB0
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
28% identity, 95% coverage: 19:421/426 of query aligns to 16:419/426 of 7tm6A
- binding glyphosate: K21 (= K24), G95 (= G94), R123 (= R122), Q170 (≠ A169), D312 (= D316), E340 (= E344), R343 (= R347), H384 (= H387), R385 (= R388)
- binding shikimate-3-phosphate: S22 (= S25), R26 (= R29), T96 (= T95), S168 (≠ D167), S169 (= S168), Q170 (≠ A169), S196 (≠ R195), Y199 (vs. gap), D312 (= D316), N335 (≠ E339), K339 (= K343)
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
27% identity, 99% coverage: 1:421/426 of query aligns to 1:420/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K24), S23 (= S25), R27 (= R29), S169 (≠ D167), S170 (= S168), Q171 (≠ A169), S197 (≠ R195), Y200 (vs. gap), D313 (= D316), N336 (≠ E339), K340 (= K343)
7m0oA Dgt-28 epsps (see paper)
26% identity, 96% coverage: 19:425/426 of query aligns to 1:398/400 of 7m0oA
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
28% identity, 95% coverage: 19:421/426 of query aligns to 17:420/427 of 2pq9A
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N92), P119 (≠ K117), R124 (= R122), D313 (= D316), E341 (= E344), H385 (= H387), R386 (= R388), K411 (≠ T412)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K24), S23 (= S25), R27 (= R29), G96 (= G94), T97 (= T95), R124 (= R122), S169 (= S168), S170 (≠ A169), Q171 (= Q170), S197 (≠ T194), Y200 (vs. gap), D313 (= D316), N336 (≠ E339), K340 (= K343), R344 (= R347), H385 (= H387), R386 (= R388), K411 (≠ T412)
2aa9A Epsp synthase liganded with shikimate (see paper)
28% identity, 95% coverage: 19:421/426 of query aligns to 17:420/427 of 2aa9A
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N92), P119 (≠ K117), R124 (= R122), D313 (= D316), E341 (= E344), H385 (= H387), R386 (= R388), K411 (≠ T412)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K24), S23 (= S25), R27 (= R29), T97 (= T95), Q171 (= Q170), Y200 (vs. gap), D313 (= D316), K340 (= K343)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
28% identity, 95% coverage: 19:421/426 of query aligns to 17:420/427 of 1x8tA
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N92), P119 (≠ K117), R124 (= R122), D313 (= D316), E341 (= E344), H385 (= H387), R386 (= R388), K411 (≠ T412)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K24), S23 (= S25), R27 (= R29), T97 (= T95), S169 (= S168), S170 (≠ A169), Q171 (= Q170), S197 (≠ T194), Y200 (vs. gap), D313 (= D316), N336 (≠ E339), K340 (= K343), R344 (= R347), H385 (= H387), R386 (= R388)
1x8rA Epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
28% identity, 95% coverage: 19:421/426 of query aligns to 17:420/427 of 1x8rA
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N92), P119 (≠ K117), R124 (= R122), D313 (= D316), E341 (= E344), H385 (= H387), R386 (= R388), K411 (≠ T412)
- binding [3r-[3a,4a,5b(s*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K24), S23 (= S25), R27 (= R29), G96 (= G94), T97 (= T95), R124 (= R122), S169 (= S168), S170 (≠ A169), Q171 (= Q170), S197 (≠ T194), Y200 (vs. gap), D313 (= D316), N336 (≠ E339), K340 (= K343), E341 (= E344), H385 (= H387), K411 (≠ T412)
Query Sequence
>WP_013134300.1 NCBI__GCF_000092245.1:WP_013134300.1
MQSFSIGALKKPFNIVIDNIASDKSISHRCAMFSLLSNETSHIKNFLTAEDTLNTLSIVE
QLGAEIKRDGSTVTITPKGTLTEPSNVLDCGNSGTAMRLFCGFLASIDGAFTLVGDKYLH
SRPMKRVANPLRSIGAKIDGREDGNKAPLFIRGVKELKAFTYHSPVDSAQVKSAMILAAL
RANGVSKYKENELTRDHTERMLKGMGAKLENDSEGFIHIYPLTKPLKPLNITVPTDPSSA
FFFALAAAITPNAKVTIKNVTLNPTRTEAYVVLKRMGANVEFIEKENVYEPMGDIVVSAN
ELNGVDVSENISWLIDELPALSIAMSLANGKSKVSNAKELRVKESDRISSVVNNLKLCGV
TYKEFEDGYEITGGKLKKATINSHGDHRIAMSFAIAGLNSGMQIQDVDCILTSFPNFKEI
LDTLKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory