Comparing WP_013136488.1 NCBI__GCF_000092245.1:WP_013136488.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P70994 2-hydroxymuconate tautomerase; (2Z,4E)-2-hydroxyhexa-2,4-dienedioate keto-enol isomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Bacillus subtilis (strain 168) (see paper)
39% identity, 90% coverage: 1:64/71 of query aligns to 1:61/62 of P70994
2opaA Ywhb binary complex with 2-fluoro-p-hydroxycinnamate
38% identity, 89% coverage: 2:64/71 of query aligns to 1:60/61 of 2opaA
Sites not aligning to the query:
>WP_013136488.1 NCBI__GCF_000092245.1:WP_013136488.1
MPYINVKMTHEDAGATKEQKEKLAKGITELFSEIFGRGASSAVILIEEVSTDNYAIGGKT
VTNIREEQKKN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory