Comparing WP_013257191.1 NCBI__GCF_000143965.1:WP_013257191.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
32% identity, 78% coverage: 26:194/217 of query aligns to 18:184/207 of 4ij6A
Sites not aligning to the query:
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
33% identity, 79% coverage: 10:180/217 of query aligns to 2:170/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
33% identity, 79% coverage: 10:180/217 of query aligns to 2:170/207 of 1h2eA
5hr5A Bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
32% identity, 80% coverage: 9:182/217 of query aligns to 222:397/424 of 5hr5A
Sites not aligning to the query:
P26285 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Bos taurus (Bovine) (see paper)
33% identity, 80% coverage: 9:182/217 of query aligns to 249:424/531 of P26285
Sites not aligning to the query:
1k6mA Crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (see paper)
31% identity, 74% coverage: 12:172/217 of query aligns to 215:366/432 of 1k6mA
Sites not aligning to the query:
P07953 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 77% coverage: 12:179/217 of query aligns to 254:412/471 of P07953
Sites not aligning to the query:
P16118 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see paper)
30% identity, 77% coverage: 12:179/217 of query aligns to 254:412/471 of P16118
Sites not aligning to the query:
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
28% identity, 79% coverage: 12:182/217 of query aligns to 222:393/425 of 5htkA
Sites not aligning to the query:
O60825 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see 2 papers)
30% identity, 79% coverage: 12:182/217 of query aligns to 252:423/505 of O60825
Sites not aligning to the query:
1tipA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
30% identity, 77% coverage: 12:179/217 of query aligns to 4:162/191 of 1tipA
1c81A Michaelis complex of fructose-2,6-bisphosphatase
30% identity, 77% coverage: 12:179/217 of query aligns to 4:162/191 of 1c81A
1c80A Regulatory complex of fructose-2,6-bisphosphatase
30% identity, 77% coverage: 12:179/217 of query aligns to 4:162/191 of 1c80A
1c7zA Regulatory complex of fructose-2,6-bisphosphatase
30% identity, 77% coverage: 12:179/217 of query aligns to 4:162/191 of 1c7zA
1fbtA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
30% identity, 77% coverage: 12:179/217 of query aligns to 3:161/190 of 1fbtA
4ma4A S-glutathionylated pfkfb3 (see paper)
31% identity, 74% coverage: 12:172/217 of query aligns to 239:390/444 of 4ma4A
Sites not aligning to the query:
6hvjA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 3 (see paper)
31% identity, 74% coverage: 12:172/217 of query aligns to 232:383/430 of 6hvjA
Sites not aligning to the query:
3qpwA Pfkfb3 in complex with aluminum tetrafluoride (see paper)
31% identity, 74% coverage: 12:172/217 of query aligns to 240:391/431 of 3qpwA
Sites not aligning to the query:
6ibyA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 6 (see paper)
31% identity, 74% coverage: 12:172/217 of query aligns to 230:381/428 of 6ibyA
Sites not aligning to the query:
5ajvB Human pfkfb3 in complex with an indole inhibitor 1 (see paper)
31% identity, 74% coverage: 12:172/217 of query aligns to 238:389/435 of 5ajvB
Sites not aligning to the query:
>WP_013257191.1 NCBI__GCF_000143965.1:WP_013257191.1
MQRRQQRKHTRVYLWRHPEVRGVADGRVYGNMDVGLTPRGQRQVALVAERMAETRLDAIY
SSDLSRSLTTAEAVGRAQKARLRPVAVRELRELNLGVWEGLTFKEIMEKYPDALKARYED
LANFKIDGGESLEEMSRRVMPAFEQIVADHRGGEVCVVSHSGVNRILLTRMLGAPLDRIF
RIDQDFACLNVVDIFNDGTPLVRRINDLMEDPAWLEH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory