Comparing WP_013257307.1 NCBI__GCF_000143965.1:WP_013257307.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
29% identity, 93% coverage: 10:251/259 of query aligns to 11:252/280 of 2pv7B
5t9fB Prephenate dehydrogenase n222d mutant from soybean (see paper)
26% identity, 94% coverage: 10:252/259 of query aligns to 4:251/253 of 5t9fB
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
29% identity, 54% coverage: 30:170/259 of query aligns to 49:194/293 of 4wjiA
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
21% identity, 78% coverage: 55:255/259 of query aligns to 69:276/286 of 3b1fA
Sites not aligning to the query:
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
25% identity, 90% coverage: 11:244/259 of query aligns to 8:257/279 of 2f1kA
Sites not aligning to the query:
>WP_013257307.1 NCBI__GCF_000143965.1:WP_013257307.1
MAESDFADFEIGIIGGSGRMGRWLVDYLQGLGCRARVAASRHAQAERDLAQNCHVLVLAV
PVGQMTTVMAELGPLTRPDGLVVDLCSLKETPLQAMLAHARGQVVGCHPLFGPTANGLDG
QTVFLCPGRGQSWLERLQNFLHTQNANVVSLTATEHDKLMAIVQSLRHILVAALGQTLAN
SDINLKAILPMAGPWFNHLAQLLQNQAAQPASLYAHLATQNPHALAPAQALRQAIDNITQ
AIQDNDENALIKYLDFSFM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory