Comparing WP_013257308.1 NCBI__GCF_000143965.1:WP_013257308.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P0A9J8 Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 from Escherichia coli (strain K12)
32% identity, 84% coverage: 52:396/410 of query aligns to 11:376/386 of P0A9J8
3mwbA The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
36% identity, 64% coverage: 135:395/410 of query aligns to 5:274/306 of 3mwbA
3mwbB The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
36% identity, 64% coverage: 135:395/410 of query aligns to 5:271/303 of 3mwbB
2qmxA The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls (see paper)
36% identity, 65% coverage: 133:400/410 of query aligns to 4:278/278 of 2qmxA
6vh5D Crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine
30% identity, 64% coverage: 132:395/410 of query aligns to 8:276/282 of 6vh5D
7am0B Gqqa- a novel type of quorum quenching acylases (see paper)
29% identity, 58% coverage: 159:396/410 of query aligns to 29:270/278 of 7am0B
3luyA Putative chorismate mutase from bifidobacterium adolescentis
26% identity, 65% coverage: 132:399/410 of query aligns to 5:287/326 of 3luyA
7alzA Gqqa- a novel type of quorum quenching acylases (see paper)
34% identity, 24% coverage: 297:396/410 of query aligns to 84:186/194 of 7alzA
5j6fA Crystal structure of dah7ps-cm complex from geobacillus sp. With prephenate (see paper)
36% identity, 20% coverage: 46:128/410 of query aligns to 2:84/352 of 5j6fA
Sites not aligning to the query:
P39912 Protein AroA(G); EC 2.5.1.54; EC 5.4.99.5 from Bacillus subtilis (strain 168) (see paper)
36% identity, 19% coverage: 52:128/410 of query aligns to 10:86/358 of P39912
Sites not aligning to the query:
5gmuB Crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with chlorogenic acid (see paper)
36% identity, 19% coverage: 52:128/410 of query aligns to 9:85/87 of 5gmuB
6al9B Crystal structure of chorismate mutase from helicobacter pylori in complex with prephenate
32% identity, 19% coverage: 52:128/410 of query aligns to 9:83/91 of 6al9B
6al9A Crystal structure of chorismate mutase from helicobacter pylori in complex with prephenate
32% identity, 19% coverage: 52:128/410 of query aligns to 8:82/90 of 6al9A
>WP_013257308.1 NCBI__GCF_000143965.1:WP_013257308.1
MTDRTPFFAGLTLGLAGGRNRRPNQKAAHLRPVYPPRQENHDMVADQINQQRQRIDEIDR
QIVDLLNERALCAMAIGRSKNAGGLPEFAPEREQAIIDALERHNQGPLSGQSLRGIFAEI
ISACRAVQRPLRVAFLGPATTFSHQAAMRHFGSSCEFAPHRSIIDVFHEVERSHAQVGVV
PVENSSEGQVSVTLDLFLESDLNVCGEIYARISQVLMSKEAAIEGIQRVYSHPQALNQCR
NWLARNMPMATLIESTSTAAAAQKAAQEDGSAAVGSILAARQGGLNALAIDIQDNPHNTT
RFFVIGRQKCPPTGNDKTSILFVTHHKPGMLFSALKHFADSGINLTRIESRPLKNTPWEY
VFFIDMAGHVEDAQVRQVINTLDEETRLLKVLGSYPMGEPEAWNGAEQAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory