Comparing WP_013257397.1 NCBI__GCF_000143965.1:WP_013257397.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3JWH7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Burkholderia pseudomallei (strain 1710b) (see paper)
58% identity, 97% coverage: 1:231/237 of query aligns to 1:232/249 of Q3JWH7
3gp5A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate (see paper)
58% identity, 97% coverage: 1:231/237 of query aligns to 1:232/248 of 3gp5A
3gp3A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 2-phosphoserine (see paper)
58% identity, 96% coverage: 1:228/237 of query aligns to 1:228/229 of 3gp3A
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
58% identity, 96% coverage: 1:228/237 of query aligns to 1:228/230 of 3fdzA
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
55% identity, 96% coverage: 1:228/237 of query aligns to 3:230/250 of P62707
Sites not aligning to the query:
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
55% identity, 96% coverage: 1:228/237 of query aligns to 1:228/239 of 1e59A
P18669 Phosphoglycerate mutase 1; BPG-dependent PGAM 1; Phosphoglycerate mutase isozyme B; PGAM-B; EC 5.4.2.11; EC 5.4.2.4 from Homo sapiens (Human) (see 4 papers)
52% identity, 92% coverage: 3:221/237 of query aligns to 5:225/254 of P18669
Sites not aligning to the query:
7xb8B Phosphoglycerate mutase 1 complexed with a covalent inhibitor
52% identity, 92% coverage: 3:221/237 of query aligns to 3:223/249 of 7xb8B
7xb7B Phosphoglycerate mutase 1 complexed with a covalent inhibitor
52% identity, 92% coverage: 3:221/237 of query aligns to 3:223/246 of 7xb7B
1yfkA Crystal structure of human b type phosphoglycerate mutase (see paper)
52% identity, 92% coverage: 3:221/237 of query aligns to 3:223/243 of 1yfkA
8itdC Phosphoglycerate mutase 1 complexed with a compound
52% identity, 92% coverage: 3:221/237 of query aligns to 4:224/242 of 8itdC
8itcC Phosphoglycerate mutase 1 complexed with a compound
52% identity, 92% coverage: 3:221/237 of query aligns to 4:224/237 of 8itcC
8itbC Phosphoglycerate mutase 1 complexed with a compound
52% identity, 92% coverage: 3:221/237 of query aligns to 4:224/237 of 8itbC
8it7C Phosphoglycerate mutase 1 complexed with a compound
52% identity, 92% coverage: 3:221/237 of query aligns to 4:224/237 of 8it7C
8it6C Phosphoglycerate mutase 1 complexed with a compound
52% identity, 92% coverage: 3:221/237 of query aligns to 4:224/237 of 8it6C
8it5C Phosphoglycerate mutase 1 complexed with a compound
52% identity, 92% coverage: 3:221/237 of query aligns to 4:224/237 of 8it5C
5y35C Phosphoglycerate mutase 1 complexed with a small molecule inhibitor kh1
52% identity, 92% coverage: 3:221/237 of query aligns to 4:224/237 of 5y35C
5y2uB X-ray structure of phosphoglycerate mutase 1(pgam1) complexed with a small molecule
52% identity, 92% coverage: 3:221/237 of query aligns to 3:223/237 of 5y2uB
5y65C Phosphoglycerate mutase 1 complexed with a small molecule inhibitor kh2
52% identity, 92% coverage: 3:221/237 of query aligns to 3:223/239 of 5y65C
8it8C Phosphoglycerate mutase 1 complexed with a compound
52% identity, 92% coverage: 3:221/237 of query aligns to 4:224/240 of 8it8C
>WP_013257397.1 NCBI__GCF_000143965.1:WP_013257397.1
MPRLLLVRHGQSQWNLENRFTGWTDVDLSPLGEDEARQAGRLLQTGGYSFDVAFTSVLKR
AVRTLWLIMERMDLYWVEQHAHWRLNERHYGALQGLNKQETTQRHGAEQVRLWRRSFDAP
PPSLDGLDPRHPRFDRRYRGVETALLPGGESLKDTLGRVLPYWTRAIEPRLRMGQDVVVA
AHGNSLRALVKHLDHVSDADIVNLEIPTGNPLVYRLAADLSVLDRAYLDQDRAQALP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory