Comparing WP_013260006.1 NCBI__GCF_000143965.1:WP_013260006.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
34% identity, 89% coverage: 17:263/276 of query aligns to 16:256/269 of 2hk9A
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
34% identity, 89% coverage: 17:263/276 of query aligns to 16:256/267 of 2hk9B
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
34% identity, 89% coverage: 17:263/276 of query aligns to 16:256/269 of O67049
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
43% identity, 92% coverage: 8:260/276 of query aligns to 3:246/263 of 2ev9B
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
43% identity, 92% coverage: 8:260/276 of query aligns to 3:246/263 of Q5SJF8
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
43% identity, 92% coverage: 8:260/276 of query aligns to 3:246/262 of 2cy0A
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
33% identity, 89% coverage: 18:263/276 of query aligns to 12:270/280 of 1o9bA
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
33% identity, 89% coverage: 18:263/276 of query aligns to 18:276/288 of 1npdB
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
33% identity, 89% coverage: 18:263/276 of query aligns to 18:276/288 of P0A6D5
Sites not aligning to the query:
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
29% identity, 92% coverage: 18:271/276 of query aligns to 24:289/291 of 3tozA
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
29% identity, 92% coverage: 18:271/276 of query aligns to 24:289/291 of Q8Y9N5
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
29% identity, 92% coverage: 18:271/276 of query aligns to 21:286/288 of 3tnlA
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
27% identity, 92% coverage: 8:261/276 of query aligns to 2:251/269 of Q5HNV1
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
27% identity, 92% coverage: 8:261/276 of query aligns to 2:242/258 of 3dooA
Q8ZPR4 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
31% identity, 94% coverage: 18:276/276 of query aligns to 18:288/288 of Q8ZPR4
P56119 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
33% identity, 77% coverage: 59:271/276 of query aligns to 59:259/263 of P56119
Sites not aligning to the query:
3phiA Shikimate 5-dehydrogenase (aroe) from helicobacter pylori in complex with shikimate and NADPH
33% identity, 77% coverage: 59:271/276 of query aligns to 59:256/259 of 3phiA
Sites not aligning to the query:
4fosA Crystal structure of shikimate dehydrogenase (aroe) q237a mutant from helicobacter pylori in complex with shikimate
33% identity, 77% coverage: 59:271/276 of query aligns to 59:259/263 of 4fosA
Sites not aligning to the query:
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
30% identity, 92% coverage: 9:261/276 of query aligns to 9:266/282 of Q58484
P44774 Shikimate dehydrogenase-like protein HI_0607; SDH-L; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
30% identity, 85% coverage: 25:258/276 of query aligns to 23:251/271 of P44774
>WP_013260006.1 NCBI__GCF_000143965.1:WP_013260006.1
MSAERFYRLGILGDERARKSLSPRMHGHVLAKHGLQGVYVALPTPPELVGQAVAEARAMD
GLNVTVPHKAAVIEFLDELAPLAQAIGAVNTIINQGGRLIGDNTDAGGFLDALAHGGFNP
SGKTALVLGAGGASRALLWALKSAGCARVLLSARRDQAAQALAADFGAQALAWAAIEDAC
PAAELLVNATAASSPAEAPELARRILALPLPAGGLTLDINYGRADNFWKAAALARDRAFS
DGLTMLALQARRSFYLWTGLDIPAGDYFEALEDYHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory