SitesBLAST
Comparing WP_013418594.1 NCBI__GCF_000166055.1:WP_013418594.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
56% identity, 96% coverage: 3:444/459 of query aligns to 2:448/455 of Q9R4E4
- KS 28:29 (= KS 29:30) binding
- R33 (= R34) binding
- NAAT 98:101 (≠ NSGT 100:103) Phosphoenolpyruvate
- A100 (≠ G102) mutation to G: Confers resistance to glyphosate.
- R128 (= R130) binding
- K353 (= K354) binding
- R357 (= R358) binding
- R405 (= R401) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
57% identity, 95% coverage: 9:444/459 of query aligns to 3:443/445 of 2pqcA
- active site: K23 (= K29), S24 (= S30), D50 (= D56), N93 (= N100), R123 (= R130), D321 (= D327), E349 (= E355), H399 (= H400), R400 (= R401), T426 (= T427)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K29), S24 (= S30), R28 (= R34), T96 (= T103), R123 (= R130), S168 (= S175), Q170 (= Q177), D321 (= D327), K348 (= K354), E349 (= E355), R352 (= R358), R400 (= R401)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
57% identity, 95% coverage: 9:444/459 of query aligns to 3:443/445 of 2pqbA
- active site: K23 (= K29), S24 (= S30), D50 (= D56), N93 (= N100), R123 (= R130), D321 (= D327), E349 (= E355), H399 (= H400), R400 (= R401), T426 (= T427)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K29), S24 (= S30), R28 (= R34), A95 (≠ G102), T96 (= T103), R123 (= R130), S168 (= S175), Q170 (= Q177), D321 (= D327), K348 (= K354), E349 (= E355), R352 (= R358), R400 (= R401)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
57% identity, 95% coverage: 9:444/459 of query aligns to 3:443/445 of 2ggaA
- active site: K23 (= K29), S24 (= S30), D50 (= D56), N93 (= N100), R123 (= R130), D321 (= D327), E349 (= E355), H399 (= H400), R400 (= R401), T426 (= T427)
- binding glyphosate: K23 (= K29), A94 (≠ S101), A95 (≠ G102), T96 (= T103), R123 (= R130), D321 (= D327), E349 (= E355), R352 (= R358), R400 (= R401)
- binding shikimate-3-phosphate: S24 (= S30), R28 (= R34), S168 (= S175), A169 (= A176), Q170 (= Q177), R195 (= R202), D321 (= D327), K348 (= K354)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
57% identity, 95% coverage: 9:444/459 of query aligns to 3:443/445 of 2gg6A
- active site: K23 (= K29), S24 (= S30), D50 (= D56), N93 (= N100), R123 (= R130), D321 (= D327), E349 (= E355), H399 (= H400), R400 (= R401), T426 (= T427)
- binding shikimate-3-phosphate: S24 (= S30), R28 (= R34), T96 (= T103), S168 (= S175), Q170 (= Q177), D321 (= D327), K348 (= K354)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
44% identity, 93% coverage: 19:443/459 of query aligns to 11:429/438 of Q83E11
- KS 21:22 (= KS 29:30) binding
- R26 (= R34) binding
- NSGT 93:96 (= NSGT 100:103) Phosphoenolpyruvate
- R123 (= R130) binding
- D315 (= D327) active site, Proton acceptor
- K342 (= K354) binding
- R346 (= R358) binding
- R387 (= R401) binding
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
44% identity, 93% coverage: 19:443/459 of query aligns to 13:431/440 of 3slhD
- active site: K23 (= K29), S24 (= S30), D50 (= D56), N95 (= N100), R125 (= R130), D317 (= D327), E345 (= E355), H388 (= H400), R389 (= R401), T415 (= T427)
- binding glyphosate: K23 (= K29), G97 (= G102), T98 (= T103), R125 (= R130), Q171 (= Q177), D317 (= D327), E345 (= E355), R348 (= R358), H388 (= H400), R389 (= R401)
- binding shikimate-3-phosphate: S24 (= S30), R28 (= R34), S169 (= S175), Q171 (= Q177), R196 (= R202), D317 (= D327), K344 (= K354)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S30), R28 (= R34), T98 (= T103), Q171 (= Q177), R196 (= R202), D317 (= D327), K344 (= K354)
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
44% identity, 93% coverage: 19:443/459 of query aligns to 13:427/434 of 4egrA
- active site: K23 (= K29), S24 (= S30), D50 (= D56), N95 (= N100), R125 (= R130), D313 (= D327), E341 (= E355), H384 (= H400), R385 (= R401), T411 (= T427)
- binding phosphoenolpyruvate: K23 (= K29), G97 (= G102), T98 (= T103), R125 (= R130), D313 (= D327), E341 (= E355), R344 (= R358), R385 (= R401)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
43% identity, 90% coverage: 18:432/459 of query aligns to 9:417/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
43% identity, 90% coverage: 18:432/459 of query aligns to 9:417/427 of 1rf6A
- active site: K20 (= K29), S21 (= S30), D47 (= D56), N90 (= N100), D115 (≠ A125), R120 (= R130), D312 (= D327), E340 (= E355), H384 (= H400), R385 (= R401), T412 (= T427)
- binding glyphosate: K20 (= K29), G92 (= G102), T93 (= T103), R120 (= R130), Q168 (= Q177), D312 (= D327), E340 (= E355), R343 (= R358), H384 (= H400), R385 (= R401)
- binding shikimate-3-phosphate: S21 (= S30), R25 (= R34), S166 (= S175), Q168 (= Q177), R193 (= R202), I311 (= I326), D312 (= D327), K339 (= K354)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
43% identity, 90% coverage: 18:432/459 of query aligns to 9:417/427 of 1rf4A
- active site: K20 (= K29), S21 (= S30), D47 (= D56), N90 (= N100), D115 (≠ A125), R120 (= R130), D312 (= D327), E340 (= E355), H384 (= H400), R385 (= R401), T412 (= T427)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K29), S21 (= S30), R25 (= R34), G92 (= G102), T93 (= T103), R120 (= R130), S166 (= S175), A167 (= A176), Q168 (= Q177), R193 (= R202), D312 (= D327), K339 (= K354), E340 (= E355), R343 (= R358), H384 (= H400), R385 (= R401)
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
30% identity, 92% coverage: 19:439/459 of query aligns to 12:424/426 of 3nvsA
- active site: K22 (= K29), S23 (= S30), D49 (= D56), N94 (= N100), P119 (≠ A125), R124 (= R130), H128 (≠ R134), Q135 (≠ S141), Y142 (≠ E148), E144 (= E149), A247 (= A249), A255 (≠ L257), D314 (= D327), E342 (= E355), H386 (= H400), R387 (= R401), K412 (≠ T427)
- binding glyphosate: K22 (= K29), G96 (= G102), R124 (= R130), Q172 (= Q177), D314 (= D327), E342 (= E355), R345 (= R358), H386 (= H400), R387 (= R401)
- binding magnesium ion: E123 (≠ K129), Q145 (≠ G150)
- binding shikimate-3-phosphate: K22 (= K29), S23 (= S30), R27 (= R34), T97 (= T103), S170 (= S175), S171 (≠ A176), Q172 (= Q177), S198 (= S198), Y201 (≠ S201), D314 (= D327), N337 (≠ E350), K341 (= K354)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S30), R27 (= R34), Q172 (= Q177), Y201 (≠ S201), D314 (= D327), K341 (= K354)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
30% identity, 92% coverage: 19:439/459 of query aligns to 12:424/426 of Q9KRB0
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
31% identity, 92% coverage: 19:438/459 of query aligns to 85:512/516 of P11043
- G173 (= G102) mutation to A: Resistance to glyphosate due to a lower affinity. Slight reduction in EPSP synthase activity.
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
31% identity, 92% coverage: 19:438/459 of query aligns to 398:826/1555 of 6hqvA
Sites not aligning to the query:
- active site: 123, 145, 187, 243, 253, 257, 261, 264, 268, 280
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding glutamic acid: 139, 145, 187, 243, 257, 264, 280
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45, 76, 79, 107, 108, 109, 112, 132, 133, 135, 139, 140, 145, 154, 175, 176, 177, 180, 280
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
- binding zinc ion: 187, 264, 280
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 90% coverage: 18:432/459 of query aligns to 11:416/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K29), S23 (= S30), R27 (= R34), S169 (= S175), S170 (≠ A176), Q171 (= Q177), S197 (= S198), Y200 (≠ S201), D313 (= D327), N336 (≠ E350), K340 (= K354)
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 90% coverage: 18:432/459 of query aligns to 10:415/426 of 7tm6A
- binding glyphosate: K21 (= K29), G95 (= G102), R123 (= R130), Q170 (= Q177), D312 (= D327), E340 (= E355), R343 (= R358), H384 (= H400), R385 (= R401)
- binding shikimate-3-phosphate: S22 (= S30), R26 (= R34), T96 (= T103), S168 (= S175), S169 (≠ A176), Q170 (= Q177), S196 (= S198), Y199 (≠ S201), D312 (= D327), N335 (≠ E350), K339 (= K354)
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
30% identity, 90% coverage: 18:432/459 of query aligns to 11:416/427 of 2pq9A
- active site: K22 (= K29), S23 (= S30), D49 (= D56), N94 (= N100), P119 (≠ A125), R124 (= R130), D313 (= D327), E341 (= E355), H385 (= H400), R386 (= R401), K411 (≠ T427)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K29), S23 (= S30), R27 (= R34), G96 (= G102), T97 (= T103), R124 (= R130), S169 (= S175), S170 (≠ A176), Q171 (= Q177), S197 (= S198), Y200 (≠ S201), D313 (= D327), N336 (≠ E350), K340 (= K354), R344 (= R358), H385 (= H400), R386 (= R401), K411 (≠ T427)
2aa9A Epsp synthase liganded with shikimate (see paper)
30% identity, 90% coverage: 18:432/459 of query aligns to 11:416/427 of 2aa9A
- active site: K22 (= K29), S23 (= S30), D49 (= D56), N94 (= N100), P119 (≠ A125), R124 (= R130), D313 (= D327), E341 (= E355), H385 (= H400), R386 (= R401), K411 (≠ T427)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K29), S23 (= S30), R27 (= R34), T97 (= T103), Q171 (= Q177), Y200 (≠ S201), D313 (= D327), K340 (= K354)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
30% identity, 90% coverage: 18:432/459 of query aligns to 11:416/427 of 1x8tA
- active site: K22 (= K29), S23 (= S30), D49 (= D56), N94 (= N100), P119 (≠ A125), R124 (= R130), D313 (= D327), E341 (= E355), H385 (= H400), R386 (= R401), K411 (≠ T427)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K29), S23 (= S30), R27 (= R34), T97 (= T103), S169 (= S175), S170 (≠ A176), Q171 (= Q177), S197 (= S198), Y200 (≠ S201), D313 (= D327), N336 (≠ E350), K340 (= K354), R344 (= R358), H385 (= H400), R386 (= R401)
Query Sequence
>WP_013418594.1 NCBI__GCF_000166055.1:WP_013418594.1
MSTHAADVRPLMSRKSGRLQGAVVVPGDKSISHRALILGALAEGRTRITGLLEAEDILCT
ARALEALGAGVERDADGAWTVTGRGLGGLAAPAGDLDFGNSGTGARLMMGVVAGHPLAAR
FTGDASLQKRPMGRVLAPLQSMGLAIEEEGRNTLPLTLVGTGDLVPISYRLPVPSAQVKS
AVLLAGLFASGETSVIESEKSRDHTEKMLRYFGAEISVEPFEGGLRIALEGRRTLQGQPV
AVPGDPSSAAFLVAAALITPASDILVKNVLVNPTRTGFYETLAEMGADISFENEREVSGE
PVADIRARTSELRGVTVPAARAPSMIDEYPMLAALATLAEGETLMEGLAELRVKESDRLA
AMVDGLVACGAIAHARGDTLTVLGLPKVRGGATIKTHMDHRIAMSFLVLGLATEEPVTVD
DASMIATSFPEFRTLMQQVGATLDEPGQASNEARGKDHE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory