Comparing WP_013420013.1 NCBI__GCF_000166055.1:WP_013420013.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
47% identity, 98% coverage: 3:415/422 of query aligns to 2:413/418 of 4xg1B
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
44% identity, 92% coverage: 27:415/422 of query aligns to 13:398/405 of B4XMC6
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
44% identity, 98% coverage: 3:415/422 of query aligns to 2:388/393 of 4xg1A
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
44% identity, 92% coverage: 27:415/422 of query aligns to 11:390/394 of 3c5qA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
38% identity, 96% coverage: 7:412/422 of query aligns to 10:424/434 of 1tufA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
38% identity, 96% coverage: 7:412/422 of query aligns to 14:428/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
38% identity, 96% coverage: 7:412/422 of query aligns to 10:424/434 of 1twiA
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
37% identity, 96% coverage: 8:413/422 of query aligns to 10:417/422 of 6n2aA
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
38% identity, 94% coverage: 18:413/422 of query aligns to 3:381/385 of 2yxxA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
38% identity, 94% coverage: 18:413/422 of query aligns to 4:382/386 of Q9X1K5
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
31% identity, 96% coverage: 11:415/422 of query aligns to 1:410/412 of 7ru7A
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
33% identity, 91% coverage: 24:407/422 of query aligns to 22:409/419 of 1ko0A
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
33% identity, 91% coverage: 24:407/422 of query aligns to 23:410/420 of P00861
1knwA Crystal structure of diaminopimelate decarboxylase
33% identity, 91% coverage: 24:407/422 of query aligns to 22:409/421 of 1knwA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
33% identity, 96% coverage: 9:415/422 of query aligns to 22:445/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
33% identity, 96% coverage: 9:415/422 of query aligns to 21:444/446 of 1hkvA
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
29% identity, 97% coverage: 4:413/422 of query aligns to 23:453/461 of 8d5rA
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
30% identity, 97% coverage: 4:413/422 of query aligns to 22:451/458 of 8d5dA
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
30% identity, 97% coverage: 4:413/422 of query aligns to 23:455/461 of 8d88A
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
30% identity, 97% coverage: 4:413/422 of query aligns to 23:455/462 of 8d4iA
>WP_013420013.1 NCBI__GCF_000166055.1:WP_013420013.1
MHHFSYKNGILHAEGAALDAIARDVGTPFYCYSTATIERHYRVFAEAFTGLDALVCYAIK
ANSNVSVIRTLAKLGSGADVVSEGEIRRALAAGIPADKIVFSGVGKTEAEMAFALDAGIY
GFNVESEAELRALSQVASGRGRTARIAFRINPDVDAKTHAKISTGKSEHKFGVSWRDARA
LYALARDLPGLDVAGVHMHIGSQITHMEPFRDAFDLMANLVEDLRRDGHTISYVNLGGGL
GIPYRWDQEVPPLPSDYAEIVIGLSNRLGARLLFEPGRIIVGNAGILVTQVIYSKHSGEK
RFVIVDAGMNDLVRPTLYDAYHDIWPVNEAQRNASIGRADVVGPVCETGDFLAKDRDMPE
LAPGDLIAVMTAGAYGAAQSSTYNTRRLVPEVLVNGADYAVVRPRPSYEDMLRAEPLAGW
LR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory