SitesBLAST
Comparing WP_013444925.1 NCBI__GCF_000183135.1:WP_013444925.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
46% identity, 86% coverage: 46:330/330 of query aligns to 36:322/334 of 5aovA
- active site: L100 (≠ V111), R241 (= R249), D265 (= D273), E270 (= E278), H288 (= H296)
- binding glyoxylic acid: M52 (≠ T62), L53 (≠ F63), L53 (≠ F63), Y74 (≠ F85), A75 (≠ G86), V76 (= V87), G77 (= G88), R241 (= R249), H288 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V87), T104 (= T115), F158 (≠ M165), G159 (= G166), R160 (= R167), I161 (= I168), S180 (≠ N187), R181 (= R188), A211 (≠ H219), V212 (= V220), P213 (= P221), T218 (= T226), I239 (≠ T247), A240 (= A248), R241 (= R249), H288 (= H296), G290 (= G298)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
45% identity, 96% coverage: 13:330/330 of query aligns to 1:321/332 of 6biiA
- active site: L99 (≠ V111), R240 (= R249), D264 (= D273), E269 (= E278), H287 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V87), T103 (= T115), G156 (= G164), F157 (≠ M165), G158 (= G166), R159 (= R167), I160 (= I168), A179 (≠ N187), R180 (= R188), S181 (≠ T189), K183 (≠ L191), V211 (= V220), P212 (= P221), E216 (= E225), T217 (= T226), V238 (≠ T247), A239 (= A248), R240 (= R249), D264 (= D273), H287 (= H296), G289 (= G298)
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
45% identity, 96% coverage: 13:330/330 of query aligns to 2:322/333 of 2dbqA
- active site: L100 (≠ V111), R241 (= R249), D265 (= D273), E270 (= E278), H288 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V87), T104 (= T115), L158 (≠ M165), G159 (= G166), R160 (= R167), I161 (= I168), S180 (≠ N187), R181 (= R188), T182 (= T189), A211 (≠ H219), V212 (= V220), P213 (= P221), T218 (= T226), I239 (≠ T247), A240 (= A248), R241 (= R249), D265 (= D273), H288 (= H296), G290 (= G298)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
45% identity, 96% coverage: 13:330/330 of query aligns to 2:322/334 of O58320
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
38% identity, 82% coverage: 55:323/330 of query aligns to 43:304/311 of 3bazA
- active site: L98 (≠ V111), R230 (= R249), A251 (= A270), D254 (= D273), E259 (= E278), H277 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V87), G149 (= G164), L150 (≠ M165), G151 (= G166), R152 (= R167), I153 (= I168), S172 (≠ N187), R173 (= R188), S174 (≠ T189), C201 (≠ V220), P202 (= P221), T207 (= T226), I228 (≠ T247), G229 (≠ A248), R230 (= R249), D254 (= D273), H277 (= H296), G279 (= G298)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
39% identity, 93% coverage: 15:322/330 of query aligns to 2:304/304 of 1wwkA
- active site: S96 (≠ V111), R230 (= R249), D254 (= D273), E259 (= E278), H278 (= H296)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ T115), G146 (= G164), F147 (≠ M165), G148 (= G166), R149 (= R167), I150 (= I168), Y168 (= Y186), D169 (≠ N187), P170 (= P192), V201 (= V220), P202 (= P221), T207 (= T226), T228 (= T247), S229 (≠ A248), D254 (= D273), H278 (= H296), G280 (= G298)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
38% identity, 82% coverage: 55:323/330 of query aligns to 45:306/313 of Q65CJ7
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
35% identity, 95% coverage: 16:330/330 of query aligns to 5:312/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
35% identity, 95% coverage: 16:330/330 of query aligns to 4:311/526 of 3dc2A
Sites not aligning to the query:
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
33% identity, 93% coverage: 15:322/330 of query aligns to 4:315/324 of 2gcgA
- active site: L103 (≠ V111), R241 (= R249), D265 (= D273), E270 (= E278), H289 (= H296)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (≠ F63), S78 (≠ G86), V79 (= V87), G80 (= G88), R241 (= R249), H289 (= H296)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V87), T107 (= T115), G156 (= G164), G158 (= G166), I160 (= I168), G180 (≠ N187), R181 (= R188), R184 (≠ L191), C212 (≠ V220), S213 (≠ P221), T218 (= T226), I239 (≠ T247), R241 (= R249), D265 (= D273), H289 (= H296), G291 (= G298)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
33% identity, 93% coverage: 15:322/330 of query aligns to 8:319/328 of Q9UBQ7
- VG 83:84 (= VG 87:88) binding substrate
- GRI 162:164 (= GRI 166:168) binding NADP(+)
- RQPR 185:188 (≠ RTKL 188:191) binding NADP(+)
- S217 (≠ P221) binding NADP(+)
- I243 (≠ T247) binding NADP(+)
- R245 (= R249) binding substrate
- D269 (= D273) binding substrate
- HIGS 293:296 (≠ HNGT 296:299) binding substrate
- G295 (= G298) binding NADP(+)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
30% identity, 88% coverage: 40:330/330 of query aligns to 32:317/533 of O43175
- T78 (≠ V87) binding NAD(+)
- R135 (≠ V147) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 167:168) binding NAD(+)
- D175 (≠ N187) binding NAD(+)
- T207 (≠ V220) binding NAD(+)
- CAR 234:236 (≠ TAR 247:249) binding NAD(+)
- D260 (= D273) binding NAD(+)
- V261 (= V274) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HNGT 296:299) binding NAD(+)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
2eklA Structure of st1218 protein from sulfolobus tokodaii
36% identity, 85% coverage: 38:317/330 of query aligns to 31:303/312 of 2eklA
- active site: S100 (≠ V111), R232 (= R249), D256 (= D273), E261 (= E278), H282 (= H296)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ V87), S100 (≠ V111), G148 (= G164), G150 (= G166), R151 (= R167), I152 (= I168), Y170 (= Y186), D171 (≠ N187), I172 (≠ R188), L173 (≠ T189), H202 (= H219), V203 (= V220), T204 (≠ P221), I212 (≠ L229), T230 (= T247), S231 (≠ A248), D256 (= D273), G284 (= G298)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
30% identity, 86% coverage: 40:322/330 of query aligns to 28:305/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
31% identity, 81% coverage: 40:306/330 of query aligns to 27:288/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V163), G147 (= G164), L148 (≠ M165), G149 (= G166), R150 (= R167), I151 (= I168), G152 (= G169), D170 (≠ N187), H201 (= H219), T202 (≠ V220), P203 (= P221)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
31% identity, 81% coverage: 40:306/330 of query aligns to 27:288/301 of 6rj5A
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
31% identity, 81% coverage: 40:306/330 of query aligns to 27:288/302 of 6rihA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
31% identity, 81% coverage: 40:306/330 of query aligns to 26:287/297 of 6rj3A
7dkmA Phgdh covalently linked to oridonin (see paper)
31% identity, 81% coverage: 40:306/330 of query aligns to 28:289/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V87), A102 (≠ T115), G148 (= G164), R151 (= R167), I152 (= I168), Y170 (= Y186), D171 (≠ N187), P172 (≠ R188), I173 (≠ T189), H202 (= H219), T203 (≠ V220), P204 (= P221), T209 (= T226), C230 (≠ T247), A231 (= A248), R232 (= R249), H279 (= H296), G281 (= G298)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
31% identity, 81% coverage: 40:306/330 of query aligns to 26:287/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ V111), A100 (≠ T115), R149 (= R167), I150 (= I168), Y168 (= Y186), D169 (≠ N187), P170 (≠ R188), I171 (≠ T189), H200 (= H219), T201 (≠ V220), P202 (= P221), T207 (= T226), C228 (≠ T247), A229 (= A248), R230 (= R249), H277 (= H296), G279 (= G298)
Query Sequence
>WP_013444925.1 NCBI__GCF_000183135.1:WP_013444925.1
MNLFSTSGNLKEKKRVLVSTRLLREGFSQLEEHFEVAFPENEVFSRNEILQLLPSFDAFV
PTFQFKVDKDIIDAGQDRLKIIANFGVGYNNIDIDYACRKNILVTNTPDPVIEPTAEQAF
ALMLAAARRVAECDRKLRLKDGLKWGVLENLGQTLYGKTIGIVGMGRIGQSLARRALANG
MKIVYYNRTKLPLDIENLYQAEWMELDNLLSASDVVSLHVPLTNETFHLIDSKKLARMKT
TAILINTARGPVVNELDLVKVLKDRRIYAAALDVYEFEPIINQELLQMDNVVLAPHNGTA
TIEARNDMARLVSQNIIRYFAGRTDINRVN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory