SitesBLAST
Comparing WP_013451120.1 NCBI__GCF_000183405.1:WP_013451120.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
53% identity, 96% coverage: 13:341/341 of query aligns to 6:342/346 of Q04797
- S98 (= S105) modified: Phosphoserine
- Y146 (≠ G153) modified: Phosphotyrosine
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
51% identity, 98% coverage: 9:341/341 of query aligns to 1:333/336 of 2r00C
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
51% identity, 98% coverage: 9:341/341 of query aligns to 2:334/337 of P23247
- C132 (= C137) active site, Acyl-thioester intermediate
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ A83), T94 (≠ S104), S95 (= S105), R98 (= R108), N126 (= N136), C127 (= C137), Q154 (= Q164), G158 (= G168), K222 (= K221), R244 (= R243), H251 (= H250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), V13 (= V23), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), S70 (= S80), A71 (= A81), G72 (= G82), T75 (≠ R85), N93 (= N103), T94 (≠ S104), P125 (= P135), N126 (= N136), C127 (= C137), G160 (= G170), M161 (≠ A171), G328 (= G327)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S104), S95 (= S105), R98 (= R108), N126 (= N136), C127 (= C137), Q154 (= Q164), G158 (= G168), E219 (= E218), K222 (= K221), R244 (= R243), H251 (= H250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), V13 (= V23), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), S70 (= S80), A71 (= A81), G72 (= G82), T75 (≠ R85), N93 (= N103), T94 (≠ S104), N126 (= N136), C127 (= C137), G160 (= G170), M161 (≠ A171), G328 (= G327)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R108), G158 (= G168), E219 (= E218), K222 (= K221), R244 (= R243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), V13 (= V23), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), S70 (= S80), A71 (= A81), G72 (= G82), T75 (≠ R85), C127 (= C137), S157 (= S167), G158 (= G168), G160 (= G170), M161 (≠ A171), N324 (≠ Q323), L325 (= L324)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), V13 (= V23), A35 (= A45), S36 (= S46), S39 (= S49), T56 (≠ L66), S70 (= S80), A71 (= A81), G72 (= G82), N93 (= N103), T94 (≠ S104), N126 (= N136), C127 (= C137), G160 (= G170), M161 (≠ A171), G328 (= G327)
- binding phthalic acid: S73 (≠ A83), T94 (≠ S104), S95 (= S105), R98 (= R108), N126 (= N136), K222 (= K221)
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G82), S73 (≠ A83), T94 (≠ S104), S95 (= S105), R98 (= R108), K222 (= K221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), V13 (= V23), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), S70 (= S80), A71 (= A81), G72 (= G82), T75 (≠ R85), N93 (= N103), T94 (≠ S104), N126 (= N136), C127 (= C137), G160 (= G170), G328 (= G327)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (= S80), G72 (= G82), S73 (≠ A83), N93 (= N103), T94 (≠ S104), S95 (= S105), R98 (= R108), K222 (= K221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), A71 (= A81), G160 (= G170), M161 (≠ A171), G162 (≠ Q172)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/357 of 4r3nA
- active site: C127 (= C137), Q154 (= Q164), R244 (= R243), H251 (= H250)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ A83), T94 (≠ S104), S95 (= S105), R98 (= R108), N126 (= N136), K222 (= K221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), V13 (= V23), A35 (= A45), S36 (= S46), S39 (= S49), T56 (≠ L66), S70 (= S80), A71 (= A81), G72 (= G82), N93 (= N103), T94 (≠ S104), N126 (= N136), C127 (= C137), G160 (= G170), M161 (≠ A171), G328 (= G327)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/357 of 3q1lA
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), A71 (= A81), T75 (≠ R85), G160 (= G170), M161 (≠ A171), G162 (≠ Q172)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R108), N126 (= N136), C127 (= C137), Q154 (= Q164), G158 (= G168), E219 (= E218), K222 (= K221), R244 (= R243)
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R108), N126 (= N136), G158 (= G168), I208 (= I207), E219 (= E218), K222 (= K221), R244 (= R243)
- binding adenosine-2'-5'-diphosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), A71 (= A81), T75 (≠ R85), G160 (= G170), M161 (≠ A171)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), A71 (= A81), T75 (≠ R85), G160 (= G170)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R108), N126 (= N136), G158 (= G168), A159 (= A169), E219 (= E218), K222 (= K221), R244 (= R243)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/357 of 2gz3A
- active site: C127 (= C137), Q154 (= Q164), R244 (= R243), H251 (= H250)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C137), Q154 (= Q164), G158 (= G168), E219 (= E218), R244 (= R243), H251 (= H250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), V13 (= V23), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), S70 (= S80), A71 (= A81), G72 (= G82), T75 (≠ R85), N93 (= N103), G158 (= G168), G160 (= G170), M161 (≠ A171), N324 (≠ Q323), A329 (= A328)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/357 of 2gz2A
- active site: C127 (= C137), Q154 (= Q164), R244 (= R243), H251 (= H250)
- binding adenosine-2'-5'-diphosphate: G8 (= G18), T10 (= T20), G11 (= G21), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), A71 (= A81), T75 (≠ R85)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/357 of 2gz1A
- active site: C127 (= C137), Q154 (= Q164), R244 (= R243), H251 (= H250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), T10 (= T20), G11 (= G21), A12 (= A22), V13 (= V23), A35 (= A45), S36 (= S46), R38 (= R48), S39 (= S49), T56 (≠ L66), S70 (= S80), A71 (= A81), G72 (= G82), T75 (≠ R85), N93 (= N103), S157 (= S167), G158 (= G168), G160 (= G170), M161 (≠ A171), N324 (≠ Q323), L325 (= L324)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
49% identity, 96% coverage: 12:339/341 of query aligns to 2:340/361 of 3pylC
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
44% identity, 96% coverage: 13:339/341 of query aligns to 3:340/342 of 3tz6A
- active site: C129 (= C137), Q156 (= Q164), R248 (= R243), H255 (= H250)
- binding cysteine: C129 (= C137), Q156 (= Q164), G160 (= G168), E223 (= E218), R248 (= R243), H255 (= H250)
- binding glycerol: S108 (≠ P118), G187 (vs. gap), F192 (vs. gap), P201 (≠ Q198), Q225 (≠ M220), R228 (≠ F223), F229 (≠ N224), Q335 (= Q334), E338 (= E337), L339 (= L338)
- binding sulfate ion: R98 (= R108), H117 (≠ A125), R119 (≠ D127), N128 (= N136), C129 (= C137), K226 (= K221), E270 (= E265), R273 (= R268)
Q57658 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
30% identity, 98% coverage: 8:341/341 of query aligns to 5:351/354 of Q57658
Query Sequence
>WP_013451120.1 NCBI__GCF_000183405.1:WP_013451120.1
MGNFKFTKKEKYNVAIAGATGAVGETFLQILEERNFPINELRLLASARSVGKTIKFKGED
YKVQELTHDSFKGIDIALFSAGASRSLEFAPSAVKAGALVIDNSSAFRMEKDIPLVVPEV
NAAAAFDNNGIIANPNCTTIIMVVALKPLHDYGKIKRVVVSSYQSSSGAGAQAMEELLAQ
TRAWAKGEPIKVEKFQHQLLFNVIPHIDKFTENGYTKEEMKMFNETRKIMGDDTIKVTAT
CVRVPVISAHSEAVTIETEKKITAEKARELLSKAPGVQVLDNPEKNEYPMPLFVAGKDDC
YVGRIREDITCDNGLTFWVVGDQLRKGAALNAIQIAELFIK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory