Comparing WP_013451917.1 NCBI__GCF_000183405.1:WP_013451917.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
40% identity, 58% coverage: 75:181/185 of query aligns to 75:183/188 of 3igjC
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
46% identity, 46% coverage: 100:185/185 of query aligns to 98:185/186 of 4isxA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
46% identity, 44% coverage: 100:181/185 of query aligns to 98:181/200 of 1krrA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
46% identity, 44% coverage: 100:181/185 of query aligns to 99:182/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
46% identity, 44% coverage: 100:181/185 of query aligns to 98:181/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
46% identity, 44% coverage: 100:181/185 of query aligns to 98:181/201 of 1kruA
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
38% identity, 54% coverage: 85:183/185 of query aligns to 83:183/190 of 5u2kA
Q93S40 Polysialic acid O-acetyltransferase; Polysialyltransferase; PST; EC 2.3.1.- from Neisseria meningitidis (see paper)
38% identity, 44% coverage: 100:181/185 of query aligns to 104:189/215 of Q93S40
Sites not aligning to the query:
2wlfA Crystallographic analysis of the polysialic acid o-acetyltransferase oatwy (see paper)
38% identity, 44% coverage: 100:181/185 of query aligns to 100:185/210 of 2wlfA
2wlgA Crystallographic analysis of the polysialic acid o-acetyltransferase oatwy (see paper)
38% identity, 44% coverage: 100:181/185 of query aligns to 100:185/211 of 2wlgA
2wleC Crystallographic analysis of the polysialic acid o-acetyltransferase oatwy (see paper)
38% identity, 44% coverage: 100:181/185 of query aligns to 100:185/211 of 2wleC
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
33% identity, 63% coverage: 69:185/185 of query aligns to 15:145/294 of 4mzuF
Sites not aligning to the query:
8j40A Crystal structure of catb8 in complex with chloramphenicol (see paper)
51% identity, 30% coverage: 130:184/185 of query aligns to 110:163/209 of 8j40A
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
33% identity, 63% coverage: 69:185/185 of query aligns to 15:144/290 of 4mzuB
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
48% identity, 33% coverage: 124:184/185 of query aligns to 108:166/211 of 4hurA
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
48% identity, 33% coverage: 124:184/185 of query aligns to 108:166/212 of 4husA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
48% identity, 33% coverage: 124:184/185 of query aligns to 108:166/206 of 6x3jA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
48% identity, 33% coverage: 124:184/185 of query aligns to 108:166/207 of 6x3cA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
48% identity, 33% coverage: 124:184/185 of query aligns to 108:166/203 of 6x3cE
Sites not aligning to the query:
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
34% identity, 44% coverage: 100:181/185 of query aligns to 98:181/185 of 3nz2J
Sites not aligning to the query:
>WP_013451917.1 NCBI__GCF_000183405.1:WP_013451917.1
MSIKGRIKEILLKMEGEDRFINRFAVKLLLMRKIGFPLYFTNFFFQRILRNQSEINFSVH
FTSKVTHIENIKIHYDLVTLTSFAVSGNCYIQAYNGLICGKNFLFAPGVKIITSGHDFKD
ITKPTKNDPVIFGDNVWIGANVVILPGVRVGNNCVIGAGSVVTKSFVEDNLIIAGNPAKV
IGKRE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory