Comparing WP_013452079.1 NCBI__GCF_000183405.1:WP_013452079.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
29% identity, 70% coverage: 43:171/183 of query aligns to 38:168/176 of 3ectA
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
29% identity, 70% coverage: 43:171/183 of query aligns to 45:175/183 of 3nz2C
Sites not aligning to the query:
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
29% identity, 70% coverage: 43:171/183 of query aligns to 48:178/185 of 3nz2J
Sites not aligning to the query:
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
30% identity, 78% coverage: 29:171/183 of query aligns to 34:178/186 of 4isxA
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
30% identity, 75% coverage: 39:176/183 of query aligns to 44:183/190 of 5u2kA
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
29% identity, 78% coverage: 29:170/183 of query aligns to 31:177/200 of 1krrA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 78% coverage: 29:170/183 of query aligns to 32:178/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
29% identity, 78% coverage: 29:170/183 of query aligns to 31:177/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
29% identity, 78% coverage: 29:170/183 of query aligns to 31:177/201 of 1kruA
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
30% identity, 70% coverage: 43:171/183 of query aligns to 49:180/188 of 3igjC
8j40A Crystal structure of catb8 in complex with chloramphenicol (see paper)
26% identity, 52% coverage: 86:181/183 of query aligns to 51:167/209 of 8j40A
Sites not aligning to the query:
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
28% identity, 52% coverage: 86:180/183 of query aligns to 50:165/208 of 2xatA
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
36% identity, 32% coverage: 124:181/183 of query aligns to 114:171/203 of 3dhoA
Sites not aligning to the query:
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
36% identity, 32% coverage: 124:181/183 of query aligns to 114:171/206 of 1khrA
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
36% identity, 32% coverage: 124:181/183 of query aligns to 114:171/209 of P50870
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
36% identity, 32% coverage: 124:181/183 of query aligns to 114:171/204 of 1mrlA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
36% identity, 32% coverage: 124:181/183 of query aligns to 114:171/205 of 1kk4A
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
33% identity, 59% coverage: 73:180/183 of query aligns to 56:169/211 of 4hurA
Sites not aligning to the query:
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
28% identity, 52% coverage: 86:180/183 of query aligns to 51:165/206 of 6u9cA
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
33% identity, 59% coverage: 73:180/183 of query aligns to 56:169/206 of 6x3jA
Sites not aligning to the query:
>WP_013452079.1 NCBI__GCF_000183405.1:WP_013452079.1
MVDLSKYDNSWYDPGNKIKILIWYFINLLFFKTSIPYPSKIKVLLLRIFGAKIGKNVVIK
PCVNIKYPWFLKIGDNVWIGENVWIDNLTTVEIGNNVCISQGAYIFTGNHNYKTQSFDLI
IKPVIIEDGVWIGAKAIVCPGVRCKSHSILSVGSVATKDLEEYTVYQGNPAVPKRKRIID
DGT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory