Comparing WP_013460285.1 NCBI__GCF_000183725.1:WP_013460285.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
6addA The crystal structure of rv2747 from mycobacterium tuberculosis in complex with coa and nlq (see paper)
34% identity, 72% coverage: 12:121/153 of query aligns to 13:124/168 of 6addA
Sites not aligning to the query:
5yo2A The crystal structure of rv2747 from mycobacterium tuberculosis in complex with acetyl coa and l-arginine (see paper)
34% identity, 72% coverage: 12:121/153 of query aligns to 13:124/168 of 5yo2A
Sites not aligning to the query:
5ygeA Arga complexed with acecoa and glutamate (see paper)
34% identity, 72% coverage: 12:121/153 of query aligns to 14:125/169 of 5ygeA
Sites not aligning to the query:
>WP_013460285.1 NCBI__GCF_000183725.1:WP_013460285.1
MNITYKKPTLLDIPAMQQLVAPEIESGVILPRSNDEIATNIRSYFLALDGEKLVGFVALH
IHSPALAELRSMIIDTAYRGRNIGTTLVENACEEGRRLGLKEVLALTYQQRFFERLGFVE
IPKESIPEHKIWADCIKCKHFPVCNEVSLIKTL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory