SitesBLAST
Comparing WP_013537272.1 NCBI__GCF_000185805.1:WP_013537272.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
47% identity, 97% coverage: 9:423/430 of query aligns to 11:422/440 of 3slhD
- active site: K23 (= K21), S24 (= S22), D50 (= D48), N95 (= N91), R125 (= R121), D317 (= D317), E345 (= E345), H388 (= H389), R389 (= R390), T415 (= T416)
- binding glyphosate: K23 (= K21), G97 (= G93), T98 (= T94), R125 (= R121), Q171 (= Q169), D317 (= D317), E345 (= E345), R348 (= R348), H388 (= H389), R389 (= R390)
- binding shikimate-3-phosphate: S24 (= S22), R28 (= R26), S169 (= S167), Q171 (= Q169), R196 (= R194), D317 (= D317), K344 (= K344)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S22), R28 (= R26), T98 (= T94), Q171 (= Q169), R196 (= R194), D317 (= D317), K344 (= K344)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
47% identity, 97% coverage: 9:423/430 of query aligns to 9:420/438 of Q83E11
- KS 21:22 (= KS 21:22) binding
- R26 (= R26) binding
- NSGT 93:96 (= NSGT 91:94) Phosphoenolpyruvate
- R123 (= R121) binding
- D315 (= D317) active site, Proton acceptor
- K342 (= K344) binding
- R346 (= R348) binding
- R387 (= R390) binding
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
46% identity, 98% coverage: 9:429/430 of query aligns to 8:425/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
46% identity, 98% coverage: 9:429/430 of query aligns to 8:425/427 of 1rf6A
- active site: K20 (= K21), S21 (= S22), D47 (= D48), N90 (= N91), D115 (≠ R116), R120 (= R121), D312 (= D317), E340 (= E345), H384 (= H389), R385 (= R390), T412 (= T416)
- binding glyphosate: K20 (= K21), G92 (= G93), T93 (= T94), R120 (= R121), Q168 (= Q169), D312 (= D317), E340 (= E345), R343 (= R348), H384 (= H389), R385 (= R390)
- binding shikimate-3-phosphate: S21 (= S22), R25 (= R26), S166 (= S167), Q168 (= Q169), R193 (= R194), I311 (= I316), D312 (= D317), K339 (= K344)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
46% identity, 98% coverage: 9:429/430 of query aligns to 8:425/427 of 1rf4A
- active site: K20 (= K21), S21 (= S22), D47 (= D48), N90 (= N91), D115 (≠ R116), R120 (= R121), D312 (= D317), E340 (= E345), H384 (= H389), R385 (= R390), T412 (= T416)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K21), S21 (= S22), R25 (= R26), G92 (= G93), T93 (= T94), R120 (= R121), S166 (= S167), A167 (= A168), Q168 (= Q169), R193 (= R194), D312 (= D317), K339 (= K344), E340 (= E345), R343 (= R348), H384 (= H389), R385 (= R390)
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
47% identity, 97% coverage: 9:423/430 of query aligns to 11:418/434 of 4egrA
- active site: K23 (= K21), S24 (= S22), D50 (= D48), N95 (= N91), R125 (= R121), D313 (= D317), E341 (= E345), H384 (= H389), R385 (= R390), T411 (= T416)
- binding phosphoenolpyruvate: K23 (= K21), G97 (= G93), T98 (= T94), R125 (= R121), D313 (= D317), E341 (= E345), R344 (= R348), R385 (= R390)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
42% identity, 98% coverage: 7:428/430 of query aligns to 14:443/455 of Q9R4E4
- KS 28:29 (= KS 21:22) binding
- R33 (= R26) binding
- NAAT 98:101 (≠ NSGT 91:94) Phosphoenolpyruvate
- A100 (≠ G93) mutation to G: Confers resistance to glyphosate.
- R128 (= R121) binding
- K353 (= K344) binding
- R357 (= R348) binding
- R405 (= R390) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
42% identity, 98% coverage: 7:428/430 of query aligns to 9:438/445 of 2pqcA
- active site: K23 (= K21), S24 (= S22), D50 (= D48), N93 (= N91), R123 (= R121), D321 (= D317), E349 (= E345), H399 (= H389), R400 (= R390), T426 (= T416)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K21), S24 (= S22), R28 (= R26), T96 (= T94), R123 (= R121), S168 (= S167), Q170 (= Q169), D321 (= D317), K348 (= K344), E349 (= E345), R352 (= R348), R400 (= R390)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
42% identity, 98% coverage: 7:428/430 of query aligns to 9:438/445 of 2pqbA
- active site: K23 (= K21), S24 (= S22), D50 (= D48), N93 (= N91), R123 (= R121), D321 (= D317), E349 (= E345), H399 (= H389), R400 (= R390), T426 (= T416)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K21), S24 (= S22), R28 (= R26), A95 (≠ G93), T96 (= T94), R123 (= R121), S168 (= S167), Q170 (= Q169), D321 (= D317), K348 (= K344), E349 (= E345), R352 (= R348), R400 (= R390)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
42% identity, 98% coverage: 7:428/430 of query aligns to 9:438/445 of 2ggaA
- active site: K23 (= K21), S24 (= S22), D50 (= D48), N93 (= N91), R123 (= R121), D321 (= D317), E349 (= E345), H399 (= H389), R400 (= R390), T426 (= T416)
- binding glyphosate: K23 (= K21), A94 (≠ S92), A95 (≠ G93), T96 (= T94), R123 (= R121), D321 (= D317), E349 (= E345), R352 (= R348), R400 (= R390)
- binding shikimate-3-phosphate: S24 (= S22), R28 (= R26), S168 (= S167), A169 (= A168), Q170 (= Q169), R195 (= R194), D321 (= D317), K348 (= K344)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
42% identity, 98% coverage: 7:428/430 of query aligns to 9:438/445 of 2gg6A
- active site: K23 (= K21), S24 (= S22), D50 (= D48), N93 (= N91), R123 (= R121), D321 (= D317), E349 (= E345), H399 (= H389), R400 (= R390), T426 (= T416)
- binding shikimate-3-phosphate: S24 (= S22), R28 (= R26), T96 (= T94), S168 (= S167), Q170 (= Q169), D321 (= D317), K348 (= K344)
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
29% identity, 97% coverage: 9:427/430 of query aligns to 83:512/516 of P11043
- G173 (= G93) mutation to A: Resistance to glyphosate due to a lower affinity. Slight reduction in EPSP synthase activity.
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
29% identity, 97% coverage: 11:428/430 of query aligns to 12:424/426 of 3nvsA
- active site: K22 (= K21), S23 (= S22), D49 (= D48), N94 (= N91), P119 (≠ R116), R124 (= R121), H128 (≠ R125), Q135 (≠ M132), Y142 (≠ G139), E144 (= E141), A247 (= A238), A255 (≠ L246), D314 (= D317), E342 (= E345), H386 (= H389), R387 (= R390), K412 (≠ T416)
- binding glyphosate: K22 (= K21), G96 (= G93), R124 (= R121), Q172 (= Q169), D314 (= D317), E342 (= E345), R345 (= R348), H386 (= H389), R387 (= R390)
- binding magnesium ion: E123 (≠ R120), Q145 (≠ G142)
- binding shikimate-3-phosphate: K22 (= K21), S23 (= S22), R27 (= R26), T97 (= T94), S170 (= S167), S171 (≠ A168), Q172 (= Q169), S198 (= S193), Y201 (vs. gap), D314 (= D317), N337 (≠ E340), K341 (= K344)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S22), R27 (= R26), Q172 (= Q169), Y201 (vs. gap), D314 (= D317), K341 (= K344)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
29% identity, 97% coverage: 11:428/430 of query aligns to 12:424/426 of Q9KRB0
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
29% identity, 97% coverage: 10:428/430 of query aligns to 11:423/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K21), S23 (= S22), R27 (= R26), S169 (≠ A166), S170 (= S167), Q171 (≠ A168), S197 (≠ P190), Y200 (≠ S193), D313 (= D317), N336 (≠ E340), K340 (= K344)
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
29% identity, 97% coverage: 10:428/430 of query aligns to 10:422/426 of 7tm6A
- binding glyphosate: K21 (= K21), G95 (= G93), R123 (= R121), Q170 (≠ A168), D312 (= D317), E340 (= E345), R343 (= R348), H384 (= H389), R385 (= R390)
- binding shikimate-3-phosphate: S22 (= S22), R26 (= R26), T96 (= T94), S168 (≠ A166), S169 (= S167), Q170 (≠ A168), S196 (≠ P190), Y199 (≠ S193), D312 (= D317), N335 (≠ E340), K339 (= K344)
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
29% identity, 97% coverage: 10:428/430 of query aligns to 11:423/427 of 2pq9A
- active site: K22 (= K21), S23 (= S22), D49 (= D48), N94 (= N91), P119 (≠ R116), R124 (= R121), D313 (= D317), E341 (= E345), H385 (= H389), R386 (= R390), K411 (≠ T416)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K21), S23 (= S22), R27 (= R26), G96 (= G93), T97 (= T94), R124 (= R121), S169 (≠ K171), S170 (= S172), Q171 (≠ S173), S197 (= S193), Y200 (vs. gap), D313 (= D317), N336 (≠ E340), K340 (= K344), R344 (= R348), H385 (= H389), R386 (= R390), K411 (≠ T416)
2aa9A Epsp synthase liganded with shikimate (see paper)
29% identity, 97% coverage: 10:428/430 of query aligns to 11:423/427 of 2aa9A
- active site: K22 (= K21), S23 (= S22), D49 (= D48), N94 (= N91), P119 (≠ R116), R124 (= R121), D313 (= D317), E341 (= E345), H385 (= H389), R386 (= R390), K411 (≠ T416)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K21), S23 (= S22), R27 (= R26), T97 (= T94), Q171 (≠ S173), Y200 (vs. gap), D313 (= D317), K340 (= K344)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
29% identity, 97% coverage: 10:428/430 of query aligns to 11:423/427 of 1x8tA
- active site: K22 (= K21), S23 (= S22), D49 (= D48), N94 (= N91), P119 (≠ R116), R124 (= R121), D313 (= D317), E341 (= E345), H385 (= H389), R386 (= R390), K411 (≠ T416)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K21), S23 (= S22), R27 (= R26), T97 (= T94), S169 (≠ K171), S170 (= S172), Q171 (≠ S173), S197 (= S193), Y200 (vs. gap), D313 (= D317), N336 (≠ E340), K340 (= K344), R344 (= R348), H385 (= H389), R386 (= R390)
1x8rA Epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
29% identity, 97% coverage: 10:428/430 of query aligns to 11:423/427 of 1x8rA
- active site: K22 (= K21), S23 (= S22), D49 (= D48), N94 (= N91), P119 (≠ R116), R124 (= R121), D313 (= D317), E341 (= E345), H385 (= H389), R386 (= R390), K411 (≠ T416)
- binding [3r-[3a,4a,5b(s*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K21), S23 (= S22), R27 (= R26), G96 (= G93), T97 (= T94), R124 (= R121), S169 (≠ K171), S170 (= S172), Q171 (≠ S173), S197 (= S193), Y200 (vs. gap), D313 (= D317), N336 (≠ E340), K340 (= K344), E341 (= E345), H385 (= H389), K411 (≠ T416)
Query Sequence
>WP_013537272.1 NCBI__GCF_000185805.1:WP_013537272.1
MVTLHFKGKKLKGELRVPSDKSISHRCIMLGSLNRGEVVVKHFLRSEDCLNTLKAFVELG
ADVTDTGTELIIKGKGKRSLKEPFNVIDLGNSGTSIRLMAGILAGQPFYSVLTGDRYLRR
RPMDRVAVPLRMMGAQIYGREGGKYPPLTIIGKEKLRGISYKSPKASAQVKSSILLAGLF
TDETVEVTEPAKSRDHTERMLRAFGVDVEENGLTVRLGKNRELAADLEIDVPADISSAAF
FIVGALITPGSEVLLKSVILNPTRTGILDVASRMGADITVLNRRSVSGEEVGDLLVRFTP
HLKATVIEGEEIPRLIDELPVIALLATQAEGETVIRDAAELRVKESDRIKSTVENLNAIG
ACVEELPDGMVIRGKTPLKGGTVSSFGDHRIAMTLAVASLITEEPVVIDEVDSVSTSYPS
FFDDLSRLLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory