Comparing WP_013537418.1 NCBI__GCF_000185805.1:WP_013537418.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2p3nA Thermotoga maritima impase tm1415 (see paper)
33% identity, 76% coverage: 36:231/259 of query aligns to 35:218/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
33% identity, 76% coverage: 36:231/259 of query aligns to 35:218/256 of O33832
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
33% identity, 88% coverage: 4:231/259 of query aligns to 4:227/255 of 5yhtA
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
33% identity, 88% coverage: 4:231/259 of query aligns to 5:228/256 of 5zonA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 88% coverage: 4:231/259 of query aligns to 7:230/260 of P95189
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
29% identity, 88% coverage: 1:229/259 of query aligns to 1:227/262 of 2qflA
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 88% coverage: 1:229/259 of query aligns to 1:227/267 of P0ADG4
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
29% identity, 88% coverage: 1:229/259 of query aligns to 5:231/270 of 6ib8B
1qgxA X-ray structure of yeast hal2p (see paper)
31% identity, 73% coverage: 71:259/259 of query aligns to 129:339/354 of 1qgxA
Sites not aligning to the query:
1ka1A The papase hal2p complexed with calcium and magnesium ions and reaction substrate: pap (see paper)
31% identity, 73% coverage: 71:259/259 of query aligns to 129:339/354 of 1ka1A
Sites not aligning to the query:
1k9zA The papase hal2p complexed with zinc ions
31% identity, 73% coverage: 71:259/259 of query aligns to 129:339/354 of 1k9zA
Sites not aligning to the query:
1k9yA The papase hal2p complexed with magnesium ions and reaction products: amp and inorganic phosphate (see paper)
31% identity, 73% coverage: 71:259/259 of query aligns to 129:339/354 of 1k9yA
Sites not aligning to the query:
P32179 3'(2'),5'-bisphosphate nucleotidase; 3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase; 3'-phosphoadenosine-5'-phosphate phosphatase; 3'-phosphoadenosine-5'-phosphatase; PAP phosphatase; PAPase; DPNPase; Halotolerance protein HAL2; Methionine-requiring protein 22; EC 3.1.3.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
31% identity, 73% coverage: 71:259/259 of query aligns to 130:340/357 of P32179
Sites not aligning to the query:
8f9yA Sal1 from arabidopsis thaliana (see paper)
31% identity, 65% coverage: 79:247/259 of query aligns to 129:320/352 of 8f9yA
Q42546 3'(2'),5'-bisphosphate nucleotidase 1; 3'(2'),5'-bisphosphonucleoside 3'(2')-phosphohydrolase 1; 3'-phosphoadenosine-5'-phosphate phosphatase 1; PAP phosphatase 1; PAPase 1; DPNPase 1; Inositol polyphosphate 1-phosphatase 1; IPPase 1; Inositol-1,4-bisphosphate 1-phosphatase 1; Phosphatase SAL1; Protein FIERY 1; EC 3.1.3.7; EC 3.1.3.57 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 65% coverage: 79:247/259 of query aligns to 129:320/353 of Q42546
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
28% identity, 94% coverage: 4:246/259 of query aligns to 3:240/258 of 3lv0A
6tqoT Rrn anti-termination complex (see paper)
29% identity, 88% coverage: 1:229/259 of query aligns to 1:219/255 of 6tqoT
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
31% identity, 84% coverage: 20:237/259 of query aligns to 23:240/266 of Q9K4B1
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 82% coverage: 27:238/259 of query aligns to 32:244/271 of Q9M8S8
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
27% identity, 92% coverage: 2:238/259 of query aligns to 3:231/259 of 2cziA
>WP_013537418.1 NCBI__GCF_000185805.1:WP_013537418.1
MEELLNLALKASLDAGKEILDVYGSGSTEVWEKQDRSPLTEADLRSHRVIMNYLRETGYP
ILSEEGKDIPYEERRQWSRFWLVDPLDGTKEFLKRNGEFTVNVALIENGKPILGVVHAPA
LGVTYFAGVGKGAFKVESEGSPKRLPLFSPVEGVVRVVASRSHLSEETERFVESLKGKFE
RVEFVAVGSSLKLCMVAEGKADIYPRFAPTMEWDTAAGQAIVEGAGGRVVNAQTGKPLLY
NKENLLNPYFIAYRGGYEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory