Comparing WP_013537965.1 NCBI__GCF_000185805.1:WP_013537965.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96C36 Pyrroline-5-carboxylate reductase 2; P5C reductase 2; P5CR 2; EC 1.5.1.2 from Homo sapiens (Human) (see paper)
39% identity, 97% coverage: 5:270/273 of query aligns to 3:274/320 of Q96C36
Sites not aligning to the query:
5uavA Structure of human pycr-1 complexed with NADPH and l-tetrahydrofuroic acid (see paper)
38% identity, 97% coverage: 5:270/273 of query aligns to 7:278/278 of 5uavA
8tcyA Structure of pycr1 complexed with 7-fluoro-2-oxo-1,2,3,4- tetrahydroquinoline-6-carboxylic acid (see paper)
38% identity, 97% coverage: 5:270/273 of query aligns to 10:281/281 of 8tcyA
5uauA Structure of human pycr-1 complexed with proline (see paper)
38% identity, 97% coverage: 5:270/273 of query aligns to 3:274/274 of 5uauA
8tcwA Structure of pycr1 complexed with 2-methyl-3-(2-oxoimidazolidin-1-yl) benzoic acid (see paper)
38% identity, 97% coverage: 5:270/273 of query aligns to 10:281/282 of 8tcwA
2graA Crystal structure of human pyrroline-5-carboxylate reductase complexed with NADP (see paper)
38% identity, 97% coverage: 5:270/273 of query aligns to 5:276/277 of 2graA
2gr9A Crystal structure of p5cr complexed with nadh (see paper)
38% identity, 97% coverage: 5:270/273 of query aligns to 5:276/277 of 2gr9A
8tcvB Structure of pycr1 complexed with 4-bromobenzene-1,3-dicarboxylic acid (see paper)
38% identity, 97% coverage: 5:269/273 of query aligns to 9:279/279 of 8tcvB
8td1A Structure of pycr1 complexed with 3-(6-oxa-9-azaspiro(4.5)decane-9- carbonyl)benzoic acid (see paper)
38% identity, 97% coverage: 5:269/273 of query aligns to 10:280/280 of 8td1A
8td0A Structure of pycr1 complexed with 5-oxo-7a-phenyl-hexahydropyrrolo[2, 1-b][1,3]thiazole-3-carboxylic acid (see paper)
38% identity, 97% coverage: 5:269/273 of query aligns to 10:280/280 of 8td0A
8tczA Structure of pycr1 complexed with 2-(pyridin-2-yl)cyclopropane-1- carboxylic acid (see paper)
38% identity, 97% coverage: 5:269/273 of query aligns to 10:280/280 of 8tczA
8tcxA Structure of pycr1 complexed with 2,4-dioxo-1,2,3,4- tetrahydroquinazoline-6-carboxylic acid (see paper)
38% identity, 97% coverage: 5:269/273 of query aligns to 10:280/280 of 8tcxA
P32322 Pyrroline-5-carboxylate reductase 1, mitochondrial; P5C reductase 1; P5CR 1; EC 1.5.1.2 from Homo sapiens (Human) (see 4 papers)
38% identity, 97% coverage: 5:270/273 of query aligns to 3:274/319 of P32322
Sites not aligning to the query:
8tcuA Structure of pycr1 complexed with 2-chloro-5-(2-oxoimidazolidin-1-yl) benzoic acid (see paper)
39% identity, 96% coverage: 5:267/273 of query aligns to 10:278/279 of 8tcuA
2izzA Crystal structure of human pyrroline-5-carboxylate reductase
39% identity, 96% coverage: 5:267/273 of query aligns to 4:272/272 of 2izzA
5uatC Structure of human pycr-1 complexed with NADPH (see paper)
38% identity, 97% coverage: 5:269/273 of query aligns to 7:277/277 of 5uatC
6xp3A Structure of human pycr1 complexed with cyclopentanecarboxylic acid (see paper)
38% identity, 97% coverage: 5:269/273 of query aligns to 6:276/276 of 6xp3A
6xp0A Structure of human pycr1 complexed with n-formyl l-proline (see paper)
38% identity, 97% coverage: 5:269/273 of query aligns to 5:272/272 of 6xp0A
6xp2A Structure of human pycr1 complexed with l-thiazolidine-4-carboxylate (see paper)
38% identity, 97% coverage: 5:270/273 of query aligns to 3:267/267 of 6xp2A
6xp1A Structure of human pycr1 complexed with l-thiazolidine-2-carboxylate (see paper)
38% identity, 97% coverage: 5:269/273 of query aligns to 3:266/266 of 6xp1A
>WP_013537965.1 NCBI__GCF_000185805.1:WP_013537965.1
MNYRVGFIGGGNMAEAFISAFVEGEFLPPGNIFVSDVRPERLKELQTLYGVNTTLNNSEV
VLNSDILFLAVKPQVMPAVLREIAEVVTPAQVVVSMAAGFPMRSIEALLGDDKKIARIMP
NIMVKVRSGVVAYCDNSRLLDEERERVLSLLEVTGAVFRLSESLFDAVTAVAGSSPAFFF
AIIEAACDGAVKVGLPRDVAKEMVLKVLEGCVKMAADEHPEVLKDRVTSPAGTTIEGLFA
LERGGVRASIIEAVSAACRRSKEISDLIEKSLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory