Comparing WP_013553448.1 NCBI__GCF_000186245.1:WP_013553448.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
47% identity, 71% coverage: 11:843/1168 of query aligns to 9:832/841 of 8g3hA
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
30% identity, 100% coverage: 5:1168/1168 of query aligns to 20:1230/1265 of Q99707
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
30% identity, 100% coverage: 5:1168/1168 of query aligns to 6:1192/1227 of P13009
Sites not aligning to the query:
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
41% identity, 46% coverage: 637:1168/1168 of query aligns to 4:506/507 of 8sseA
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
32% identity, 51% coverage: 5:605/1168 of query aligns to 4:599/611 of 4cczA
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
48% identity, 23% coverage: 343:616/1168 of query aligns to 3:279/282 of 5vooA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
30% identity, 50% coverage: 1:579/1168 of query aligns to 1:538/559 of 1q8jA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
30% identity, 50% coverage: 1:579/1168 of query aligns to 1:538/560 of 3bofA
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
28% identity, 46% coverage: 629:1168/1168 of query aligns to 3:542/577 of 3bulA
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
28% identity, 46% coverage: 629:1168/1168 of query aligns to 3:542/576 of 3ivaA
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
38% identity, 18% coverage: 629:839/1168 of query aligns to 3:218/246 of 1bmtA
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
33% identity, 20% coverage: 345:579/1168 of query aligns to 7:246/287 of 3k13C
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
32% identity, 20% coverage: 343:578/1168 of query aligns to 11:237/271 of 2ycjA
2yciX Methyltransferase native (see paper)
32% identity, 20% coverage: 343:578/1168 of query aligns to 11:237/271 of 2yciX
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
32% identity, 20% coverage: 343:578/1168 of query aligns to 12:238/272 of 2yckX
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
31% identity, 20% coverage: 343:577/1168 of query aligns to 2:227/262 of 4djfA
4djeA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate (see paper)
31% identity, 20% coverage: 343:577/1168 of query aligns to 2:227/262 of 4djeA
4djdA Crystal structure of folate-free corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr) (see paper)
31% identity, 20% coverage: 343:577/1168 of query aligns to 2:227/262 of 4djdA
2e7fA 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 angsrom resolution (see paper)
31% identity, 20% coverage: 343:577/1168 of query aligns to 2:227/262 of 2e7fA
Q46389 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein co-methyltransferase; 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase; MeTr; EC 2.1.1.258 from Moorella thermoacetica (Clostridium thermoaceticum) (see 2 papers)
31% identity, 20% coverage: 343:577/1168 of query aligns to 2:227/262 of Q46389
>WP_013553448.1 NCBI__GCF_000186245.1:WP_013553448.1
MKPADRIREIIAERYLVIDGAMGTQIQDLKVPAEAWLDEKGESQEGCNELLNATAPELIG
RIHKRYAMAGADMIKTNTFGAMPWVLDEYGLGERAYELSRKGAELVKAVCEEYSTPEKPR
FVLGSIGPGTKLPSLGHIDYEAMYEGYLETARGLIDGGCDVFLLETCQDPLQIKAALHAC
EAANAEKSASLPIMVSVTIELSGSMLIGTDAATIVTILEPFDILSLGFNCGTGPDQVKKH
LKTLSERCKFPISVHSNAGLPQNRGGHTFYPMGPDEFAKKELEFIDFDGVAFLGGCCGTT
PQHIQALAKAIEGKKPKSPTGSIPPSIASLFESVELFQDPAPLLIGERSNATGSKAFRQL
ILDEDYEGTLTVAQEQVRAGAHALDVNVEFAGRDGAKDMKEVISLYNQKIPIPLMPDATN
VHTMEVGLRRIGGRPIINSANLEDGIERFDRICRLAKKYGAALVLLTIDETGMAKEKERK
VEVAERMIERAVNLHGLRKEELIVDVLTFTVGSGDEEYRDAAVQTLEAIRELHKRHPELG
TTLGLSNISFGLAPHARVYLNSVFLHHCVEAGLSSVIINVKHIVPLSRMSEEDIAVCEEL
LFHADENSLFRFIEHFSDKSLETEQTDEEYEKLSTEEKIQKLLMDGDKERLIPLVEEARH
ELGADRIVNEILIDGMKVIGELFGSGQMQLPFVLQSAETMKATVDYLNPYLTKQEKESDT
TLVIGTVKGDVHDVGKNLVDIILSNNGFKVKNIGIKVELEQFLEAYEEVNADAIGMSGLL
VKSTQVMKENLEELARRGIEIPIIMGGAALTRGFVDDYCRPIYKGPIFYCRDAFDGVVAM
SRIEEWKKDPSKPLDTRMAGDMNERVVKEKKEVVIPPFEEIKMPKPVEIPTPPFWGRRVM
DRENLDLSMIFDWVNKRTLFKMHWGYKSKGMSKEEYQKLLDKTVYPAWERLKDTFLKEKL
FEPTILYGYYPCRSDDQELFLFSPDEGWFSESEVNREPLEEIVGRAVGVFNFPRQRRKPY
RALSDFFRHERHDVVALTCVSAGPKITEYERALYEKGEYLEYNLVHGLGVELAEALAEVA
HKQIRLDLGIASEDEGHTLRDVRMNRYRGARYSFGYAACPDLEQSRVIFDLLEPEEFGIE
LSETFQIHPEQSTTAIVVHHPEATYYAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory