Comparing WP_013553651.1 NCBI__GCF_000186245.1:WP_013553651.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P56119 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
39% identity, 99% coverage: 1:263/266 of query aligns to 1:263/263 of P56119
4fosA Crystal structure of shikimate dehydrogenase (aroe) q237a mutant from helicobacter pylori in complex with shikimate
39% identity, 99% coverage: 1:263/266 of query aligns to 1:263/263 of 4fosA
3phiA Shikimate 5-dehydrogenase (aroe) from helicobacter pylori in complex with shikimate and NADPH
39% identity, 98% coverage: 1:260/266 of query aligns to 1:257/259 of 3phiA
3phjA Shikimate 5-dehydrogenase (aroe) from helicobacter pylori in complex with 3-dehydroshikimate
38% identity, 99% coverage: 1:263/266 of query aligns to 1:255/255 of 3phjA
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
35% identity, 97% coverage: 4:261/266 of query aligns to 2:268/272 of P15770
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
35% identity, 97% coverage: 4:261/266 of query aligns to 2:268/271 of 1nytA
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
38% identity, 97% coverage: 6:263/266 of query aligns to 4:261/262 of 2cy0A
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
38% identity, 97% coverage: 6:263/266 of query aligns to 4:261/263 of 2ev9B
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
38% identity, 97% coverage: 6:263/266 of query aligns to 4:261/263 of Q5SJF8
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
32% identity, 97% coverage: 4:261/266 of query aligns to 7:266/267 of 2hk9B
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
32% identity, 97% coverage: 4:261/266 of query aligns to 7:266/269 of 2hk9A
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
32% identity, 97% coverage: 4:261/266 of query aligns to 7:266/269 of O67049
P43876 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
33% identity, 96% coverage: 4:259/266 of query aligns to 2:271/272 of P43876
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
31% identity, 96% coverage: 6:261/266 of query aligns to 3:259/269 of Q5HNV1
1p77A Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae (see paper)
32% identity, 96% coverage: 4:259/266 of query aligns to 2:264/265 of 1p77A
2gptA Crystal structure of arabidopsis dehydroquinate dehydratase-shikimate dehydrogenase in complex with tartrate and shikimate (see paper)
32% identity, 92% coverage: 2:246/266 of query aligns to 233:473/498 of 2gptA
Sites not aligning to the query:
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
30% identity, 96% coverage: 6:261/266 of query aligns to 3:250/258 of 3dooA
6bmqA Crystal structure of arabidopsis dehydroquinate dehydratase-shikimate dehydrogenase (t381g mutant) in complex with tartrate and shikimate (see paper)
32% identity, 92% coverage: 2:246/266 of query aligns to 233:473/498 of 6bmqA
Sites not aligning to the query:
Q9SQT8 Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic; DHQ-SDH protein; DHQase-SORase; Protein EMBRYO DEFECTIVE 3004; EC 4.2.1.10; EC 1.1.1.25 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 92% coverage: 2:246/266 of query aligns to 322:587/603 of Q9SQT8
Sites not aligning to the query:
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
32% identity, 92% coverage: 2:246/266 of query aligns to 233:475/500 of 2o7sA
Sites not aligning to the query:
>WP_013553651.1 NCBI__GCF_000186245.1:WP_013553651.1
MDRELFAIFGNPVAHSRSPLMHNYTFQTLDYPACYGRYRLEEGERLREVFLKLGLKGANI
TVPHKEHAYRACDELDDFARKVGAVNTIVLRDGKLHGYNTDAPGFLRVVEEFGGGKRVLF
LGAGGTAASTAMILREAGYEVTILNRSAGRLESFKEQGFAAYTWEEFAPGAYDLIVNMSS
AGLEDESLPAPREILEPLLRRASGALDVIYGKETPFLRLARSLGVRSKDGSEMLLYQGVI
AFDYFTEGHFDLEKIEKAMRESFFLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory