Comparing WP_013553922.1 NCBI__GCF_000186245.1:WP_013553922.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P58315 Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; FBPA; EC 4.1.2.13 from Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1) (see paper)
33% identity, 94% coverage: 16:303/305 of query aligns to 2:263/263 of P58315
2yceE Structure of an archaeal fructose-1,6-bisphosphate aldolase with the catalytic lys covalently bound to the carbinolamine intermediate of the substrate. (see paper)
33% identity, 87% coverage: 24:287/305 of query aligns to 4:245/255 of 2yceE
1w8sA The mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates (see paper)
33% identity, 87% coverage: 24:287/305 of query aligns to 4:245/250 of 1w8sA
P58314 Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; EC 4.1.2.13 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
32% identity, 88% coverage: 34:300/305 of query aligns to 21:274/281 of P58314
P0A991 Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; EC 4.1.2.13 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 87% coverage: 32:295/305 of query aligns to 64:346/350 of P0A991
Sites not aligning to the query:
2qjgA M. Jannaschii adh synthase complexed with f1,6p (see paper)
30% identity, 71% coverage: 86:302/305 of query aligns to 68:268/272 of 2qjgA
Sites not aligning to the query:
>WP_013553922.1 NCBI__GCF_000186245.1:WP_013553922.1
MIREDFRDFLPADVPADKEKEFLENFEKSTGGSGRLMLFAGDQKVEHLNNDFHGEGIPEE
DNDPEHLFRIAKMAKIGVFATQFGLISRYGRDYKDVPYLVKLNSKTNLVPYDAKDPYSQQ
WLEVEDVVRFRDSSGLDIRGVGYTVYLGGEHEHSMLREAARIVHEAHSHGMLAVLWMYPK
GPFVKNEHDPHLIAGAAGVAACLGADFAKVKVPYDKEGQPLPELLQEATTAAGRTGVLCE
GGSRIDEETFLRQLHEQIHIGHSRGNGTGRNIHQRPLQEAVKMADAIYAVTCENKSVKEA
LEILA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory