Comparing WP_013554059.1 NCBI__GCF_000186245.1:WP_013554059.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
39% identity, 99% coverage: 1:406/410 of query aligns to 2:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
39% identity, 99% coverage: 1:406/410 of query aligns to 2:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
32% identity, 97% coverage: 8:403/410 of query aligns to 12:407/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
22% identity, 95% coverage: 4:394/410 of query aligns to 18:428/456 of 5j7iB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
22% identity, 95% coverage: 4:394/410 of query aligns to 17:427/455 of 5j7iC
6dbbA Crystal structure of a putative aldehyde dehydrogenase family protein burkholderia cenocepacia j2315 in complex with partially reduced nadh
42% identity, 18% coverage: 306:379/410 of query aligns to 391:467/504 of 6dbbA
Sites not aligning to the query:
>WP_013554059.1 NCBI__GCF_000186245.1:WP_013554059.1
MEGFLQKAKASSAVIATLDGATKSRVLRKMADALEEEMESILQANAKDMAAAEENELSSA
LKDRLFLDEKRVEAMARSLREIAALREPVGRVLEGWRNDANLRIEKVSVPIGVVGVIYES
RPNVTADVGALCFKSGNVAILKGGKEAEHSNRAIAEVLQGVLEAEGLPREIISLLPDSSR
EGVAYLIRQDRYVDLIVPRGGETLIRYVSENATVPVVKHDKGLCHTYVHRAADQEMALKI
ALNAKCDRPGVCNAMETLLVDRAIARDFLPKAYEAFRAAGTELRADEEACGIIDAALAAE
EDWDTEYLANILAVKVVENIDEAITHIRRHGSGHSEAIITEDYRAAEKFLDEVDAACVYV
NASTRFTDGGAFGFGAEVGISTNKLHARGPMGINELTTYKYKIYGEGQTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory