Comparing WP_013554584.1 NCBI__GCF_000186245.1:WP_013554584.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
41% identity, 98% coverage: 5:361/364 of query aligns to 7:371/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
41% identity, 98% coverage: 5:361/364 of query aligns to 7:371/376 of 4o23A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
40% identity, 96% coverage: 14:362/364 of query aligns to 16:372/377 of 7t1qA
7lgpB Dape enzyme from shigella flexneri
38% identity, 99% coverage: 3:362/364 of query aligns to 7:373/377 of 7lgpB
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
37% identity, 99% coverage: 2:361/364 of query aligns to 4:371/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
38% identity, 99% coverage: 2:361/364 of query aligns to 8:375/380 of 5vo3A
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
36% identity, 49% coverage: 2:179/364 of query aligns to 6:196/258 of 4h2kA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
38% identity, 46% coverage: 3:171/364 of query aligns to 5:180/265 of 4op4B
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 91% coverage: 35:364/364 of query aligns to 46:381/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
28% identity, 54% coverage: 10:206/364 of query aligns to 12:213/380 of 7rsfA
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 87% coverage: 29:345/364 of query aligns to 53:379/408 of Q03154
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
24% identity, 82% coverage: 54:350/364 of query aligns to 94:406/426 of 3pfoA
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
25% identity, 86% coverage: 52:364/364 of query aligns to 49:337/341 of 5xoyA
3ki9A Crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the mn2+ bound form (see paper)
36% identity, 25% coverage: 59:148/364 of query aligns to 83:174/467 of 3ki9A
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
29% identity, 51% coverage: 14:199/364 of query aligns to 24:196/366 of Q8P8J5
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
23% identity, 78% coverage: 63:345/364 of query aligns to 79:378/407 of P37111
Sites not aligning to the query:
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
28% identity, 51% coverage: 14:199/364 of query aligns to 25:191/360 of 2f7vA
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
29% identity, 35% coverage: 63:191/364 of query aligns to 124:264/503 of Q8C165
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
30% identity, 35% coverage: 29:156/364 of query aligns to 47:175/192 of 1q7lA
1lfwA Crystal structure of pepv (see paper)
52% identity, 13% coverage: 52:97/364 of query aligns to 74:121/468 of 1lfwA
Sites not aligning to the query:
>WP_013554584.1 NCBI__GCF_000186245.1:WP_013554584.1
MEVTDLLIRLLSAPSVTPDDAGLMEFVQEYLPGYEIIRLDEGGVKNLFMYRKFGEGEHLC
FAGHVDVVPPGEGWRSDPFTPRIEKGVITARGAQDMKSGVAAFVEAMKRAERFNGTLSLL
LTSDEEGDATYGTRIMLAHLRQIGLLPDYAIVAEPTCEERFGDAIKIGRRGSINGVIEKR
GRQGHAAYPEKAVNPIHKVSQVLPHMAGVNLDEGDEFFAPSQFVITDIRAGMEVTNVTPG
KLKMMFNVRNNTHTDLKDVEEFVHRYFSGMDYDLKLSQSAKPFVTDPDTRVVRVLDRAIA
EVTGLAPKHSTAGGTSDARFFAEYGVKVVEFGVRNDTIHAPNERVPIDEVEGLYRVFRRV
IEAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory