Comparing WP_013643971.1 NCBI__GCF_000191585.1:WP_013643971.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
5odcD Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
65% identity, 96% coverage: 3:138/142 of query aligns to 1:136/138 of 5odcD
7bkbF Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
55% identity, 92% coverage: 7:136/142 of query aligns to 5:134/137 of 7bkbF
>WP_013643971.1 NCBI__GCF_000191585.1:WP_013643971.1
MAEDDVKIVMFCCNWCSYGGADTAGTARMQYPPNVRVIRVMCSGRIEPQFVFKAFREGAD
GVIVAGCHHGDCHYDAGNYKLDRRMRLIYKLAEDLGIGRERIYHDWISASEGEKFANTVT
MMVNRIKGLGKSPLKEQLSVEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory