Comparing WP_013644807.1 NCBI__GCF_000191585.1:WP_013644807.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
49% identity, 72% coverage: 3:353/489 of query aligns to 5:359/387 of Q6FEQ3
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
44% identity, 69% coverage: 20:358/489 of query aligns to 14:347/358 of P45131
Sites not aligning to the query:
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
40% identity, 70% coverage: 20:362/489 of query aligns to 9:338/346 of 5w8oB
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
38% identity, 73% coverage: 11:367/489 of query aligns to 9:371/374 of D2Z028
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
38% identity, 70% coverage: 20:362/489 of query aligns to 18:357/367 of 8f2lA
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
38% identity, 70% coverage: 20:362/489 of query aligns to 19:358/366 of 6puxA
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
38% identity, 70% coverage: 20:362/489 of query aligns to 18:357/368 of 7rytB
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
38% identity, 70% coverage: 20:362/489 of query aligns to 19:358/375 of 6iohA
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
38% identity, 70% coverage: 20:362/489 of query aligns to 19:358/366 of 6ioiA
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
37% identity, 72% coverage: 20:369/489 of query aligns to 19:350/350 of 2vavB
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
37% identity, 71% coverage: 20:366/489 of query aligns to 18:345/347 of 2vatA
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
42% identity, 57% coverage: 20:298/489 of query aligns to 90:368/504 of Q10341
Sites not aligning to the query:
Q8TPT4 L-aspartate semialdehyde sulfurtransferase; EC 2.8.1.16 from Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) (see 2 papers)
42% identity, 24% coverage: 370:488/489 of query aligns to 379:498/500 of Q8TPT4
Sites not aligning to the query:
Q57564 L-aspartate semialdehyde sulfurtransferase; EC 2.8.1.16 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
43% identity, 24% coverage: 369:485/489 of query aligns to 388:504/509 of Q57564
3kpcA Crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine (see paper)
43% identity, 24% coverage: 369:485/489 of query aligns to 3:119/124 of 3kpcA
4gqyA Crystal structure of cbsx2 in complex with amp (see paper)
33% identity, 21% coverage: 382:482/489 of query aligns to 17:138/147 of 4gqyA
3lfzA Crystal structure of protein mj1225 from methanocaldococcus jannaschii, a putative archaeal homolog of g-ampk. (see paper)
31% identity, 22% coverage: 371:478/489 of query aligns to 86:195/280 of 3lfzA
Sites not aligning to the query:
2yzqA Crystal structure of uncharacterized conserved protein from pyrococcus horikoshii
39% identity, 15% coverage: 403:477/489 of query aligns to 138:214/224 of 2yzqA
3ddjA Crystal structure of a cbs domain-containing protein in complex with amp (sso3205) from sulfolobus solfataricus at 1.80 a resolution
27% identity, 22% coverage: 371:478/489 of query aligns to 142:259/279 of 3ddjA
Sites not aligning to the query:
5g5xA Cbs domain tandem of site-2 protease from archaeoglobus fulgidus in complex with llama nanobody - nucleotide-bound form (see paper)
32% identity, 22% coverage: 373:478/489 of query aligns to 2:103/119 of 5g5xA
Sites not aligning to the query:
>WP_013644807.1 NCBI__GCF_000191585.1:WP_013644807.1
MKNESIGIVETKYHSLSDDLILESGEKLKNVQVAYETYGKLNKEKSNAILVCHALTGDAH
VAGWYEGDKKPGWWDVIIGPGKCLDTEKYFIICSNVIGGCKGSTGPSSINPETNKPYGLD
FPIITIKDMVNAQKKLVNSMGVTQLFAVIGGSMGGMQVLQWCVSYPDMVRSAIPIATTAF
SSPQQIAFNEVGRRAIISDPNWNNGQYYDSEVPTEGLALARMIAHITYLSNESMYQKFGR
RLQDKEDYGFDFETDFEVESYLHYQGNSFTKRFDANSYLYITKAVDYFDLAGEGSLAETF
YGLKIKFLVISVDSDWLYPPSLSRDIVMGLNANDINVSYCEIKSSYGHDAFLIEAGQLNY
LIAGFLSDTLVKDVMAKEFPKIKEKSSIEHAAELMLHEKVTHLPVVTDNSTLLGIVTAWD
ISKSVARNYKELDDIMTKEVIVVSPEDPIELAARKMKKYSISSLPVVDESETVIGIVTMD
HVSSMMTEN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory