SitesBLAST
Comparing WP_013683034.1 NCBI__GCF_000194625.1:WP_013683034.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4uqvG Methanococcus jannaschii serine hydroxymethyl-transferase in complex with plp (see paper)
52% identity, 97% coverage: 13:406/406 of query aligns to 16:426/429 of 4uqvG
- active site: Y50 (= Y47), E52 (≠ M49), D196 (= D191), S223 (= S218), K226 (= K221), Q232 (= Q227)
- binding pyridoxal-5'-phosphate: G93 (= G90), V94 (≠ T91), H121 (= H118), A198 (≠ S193), H199 (= H194), S223 (= S218), H225 (= H220), K226 (= K221)
4bhdB Methanococcus jannaschii serine hydroxymethyl-transferase, apo form (see paper)
49% identity, 97% coverage: 13:406/406 of query aligns to 15:392/395 of 4bhdB
2vmyA Crystal structure of f351gbsshmt in complex with gly and fthf (see paper)
37% identity, 92% coverage: 6:377/406 of query aligns to 10:387/405 of 2vmyA
- active site: Y51 (= Y47), E53 (≠ M49), D197 (= D191), T223 (≠ S218), K226 (= K221), R232 (≠ Q227)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: E53 (≠ M49), Y60 (≠ A56), Y61 (= Y57), L117 (≠ V113), G121 (= G117), H122 (= H118), L123 (≠ T119), S172 (= S166), K248 (≠ Y243), F251 (≠ M246), N341 (≠ C334), S349 (= S339), P350 (≠ E340), G351 (= G341), R357 (= R347)
- binding glycine: S31 (= S27), Y51 (= Y47), Y61 (= Y57), H200 (= H194), K226 (= K221), R357 (= R347)
- binding pyridoxal-5'-phosphate: Y51 (= Y47), S93 (= S89), G94 (= G90), A95 (≠ T91), H122 (= H118), S172 (= S166), D197 (= D191), A199 (≠ S193), H200 (= H194), T223 (≠ S218), K226 (= K221), G257 (≠ N252)
2vmxA Crystal structure of f351gbsshmt in complex with l-allo-thr (see paper)
37% identity, 92% coverage: 6:377/406 of query aligns to 10:387/405 of 2vmxA
- active site: Y51 (= Y47), E53 (≠ M49), D197 (= D191), T223 (≠ S218), K226 (= K221), R232 (≠ Q227)
- binding allo-threonine: S31 (= S27), H122 (= H118), H200 (= H194), R357 (= R347)
- binding pyridoxal-5'-phosphate: S93 (= S89), G94 (= G90), A95 (≠ T91), H122 (= H118), S172 (= S166), D197 (= D191), A199 (≠ S193), H200 (= H194), T223 (≠ S218), K226 (= K221)
4otlA X-ray crystal structure of serine hydroxymethyl transferase from burkholderia cenocepacia bound to plp and glycine
36% identity, 95% coverage: 6:390/406 of query aligns to 9:405/409 of 4otlA
- active site: Y50 (= Y47), E52 (≠ M49), D195 (= D191), T221 (≠ S218), K224 (= K221), R230 (≠ Q227)
- binding glycine: S30 (= S27), Y50 (= Y47), Y60 (= Y57), H121 (= H118), K224 (= K221), R355 (= R347)
- binding pyridoxal-5'-phosphate: S92 (= S89), G93 (= G90), S94 (≠ T91), H121 (= H118), S170 (= S166), D195 (= D191), A197 (≠ S193), H198 (= H194), K224 (= K221)
4n0wA X-ray crystal structure of a serine hydroxymethyltransferase from burkholderia cenocepacia with covalently attached pyridoxal phosphate
36% identity, 95% coverage: 6:390/406 of query aligns to 16:412/416 of 4n0wA
- active site: Y57 (= Y47), E59 (≠ M49), D202 (= D191), T228 (≠ S218), K231 (= K221), R237 (≠ Q227)
- binding pyridoxal-5'-phosphate: S99 (= S89), G100 (= G90), S101 (≠ T91), H128 (= H118), D202 (= D191), A204 (≠ S193), H205 (= H194), K231 (= K221)
4ot8A X-ray crystal structure of serine hydroxymethyl transferase from burkholderia cenocepacia bound to plp and serine
36% identity, 95% coverage: 6:390/406 of query aligns to 14:410/414 of 4ot8A
- active site: Y55 (= Y47), E57 (≠ M49), D200 (= D191), T226 (≠ S218), K229 (= K221), R235 (≠ Q227)
- binding pyridoxal-5'-phosphate: S97 (= S89), G98 (= G90), S99 (≠ T91), H126 (= H118), D200 (= D191), A202 (≠ S193), H203 (= H194), K229 (= K221)
- binding serine: S35 (= S27), E57 (≠ M49), Y65 (= Y57), H126 (= H118), H203 (= H194), R360 (= R347)
1kl2A Crystal structure of serine hydroxymethyltransferase complexed with glycine and 5-formyl tetrahydrofolate (see paper)
37% identity, 92% coverage: 6:377/406 of query aligns to 10:387/405 of 1kl2A
- active site: Y51 (= Y47), E53 (≠ M49), D197 (= D191), T223 (≠ S218), K226 (= K221), R232 (≠ Q227)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: E53 (≠ M49), Y60 (≠ A56), G121 (= G117), H122 (= H118), S172 (= S166), F251 (≠ M246), N341 (≠ C334)
- binding glycine: S31 (= S27), Y51 (= Y47), Y61 (= Y57), H200 (= H194), R357 (= R347)
- binding pyridoxal-5'-phosphate: S93 (= S89), G94 (= G90), A95 (≠ T91), H122 (= H118), S172 (= S166), D197 (= D191), A199 (≠ S193), H200 (= H194), T223 (≠ S218), H225 (= H220), K226 (= K221)
1kl1A Crystal structure of serine hydroxymethyltransferase complexed with glycine (see paper)
37% identity, 92% coverage: 6:377/406 of query aligns to 10:387/405 of 1kl1A
- active site: Y51 (= Y47), E53 (≠ M49), D197 (= D191), T223 (≠ S218), K226 (= K221), R232 (≠ Q227)
- binding glycine: S31 (= S27), H122 (= H118), R357 (= R347)
- binding pyridoxal-5'-phosphate: S93 (= S89), G94 (= G90), A95 (≠ T91), H122 (= H118), A171 (= A165), S172 (= S166), D197 (= D191), A199 (≠ S193), H200 (= H194), T223 (≠ S218), H225 (= H220), K226 (= K221)
1kkpA Crystal structure of serine hydroxymethyltransferase complexed with serine (see paper)
37% identity, 92% coverage: 6:377/406 of query aligns to 10:387/405 of 1kkpA
- active site: Y51 (= Y47), E53 (≠ M49), D197 (= D191), T223 (≠ S218), K226 (= K221), R232 (≠ Q227)
- binding pyridoxal-5'-phosphate: S93 (= S89), G94 (= G90), A95 (≠ T91), H122 (= H118), S172 (= S166), D197 (= D191), A199 (≠ S193), H200 (= H194), K226 (= K221)
- binding serine: S31 (= S27), H122 (= H118), R357 (= R347)
1kkjA Crystal structure of serine hydroxymethyltransferase from b.Stearothermophilus (see paper)
37% identity, 92% coverage: 6:377/406 of query aligns to 10:387/405 of 1kkjA
- active site: Y51 (= Y47), E53 (≠ M49), D197 (= D191), T223 (≠ S218), K226 (= K221), R232 (≠ Q227)
- binding pyridoxal-5'-phosphate: S93 (= S89), G94 (= G90), A95 (≠ T91), H122 (= H118), S172 (= S166), D197 (= D191), A199 (≠ S193), H200 (= H194), T223 (≠ S218), H225 (= H220), K226 (= K221)
Q5SI56 Serine hydroxymethyltransferase; SHMT; Serine methylase; EC 2.1.2.1 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
36% identity, 92% coverage: 1:374/406 of query aligns to 5:385/407 of Q5SI56
- Y51 (= Y47) binding
- GS 94:95 (≠ GT 90:91) binding
- S172 (= S166) binding
- H200 (= H194) binding
- H225 (= H220) binding
- K226 (= K221) modified: N6-(pyridoxal phosphate)lysine
- G258 (≠ N252) binding
8suiB Joint x-ray/neutron structure of thermus thermophilus serine hydroxymethyltransferase (tthshmt) in internal aldimine state with l- ser bound in a pre-michalis complex (see paper)
37% identity, 91% coverage: 5:374/406 of query aligns to 4:380/402 of 8suiB
8ssyA Room-temperature x-ray structure of thermus thermophilus serine hydroxymethyltransferase (shmt) bound with d-ser in a pseudo- michaelis complex (see paper)
37% identity, 91% coverage: 5:374/406 of query aligns to 4:380/402 of 8ssyA
2dkjA Crystal structure of t.Th.Hb8 serine hydroxymethyltransferase
37% identity, 91% coverage: 5:374/406 of query aligns to 4:380/402 of 2dkjA
- active site: Y46 (= Y47), E48 (≠ M49), D192 (= D191), T218 (≠ S218), K221 (= K221), R227 (≠ Q227)
- binding pyridoxal-5'-phosphate: S88 (= S89), G89 (= G90), S90 (≠ T91), H117 (= H118), S167 (= S166), D192 (= D191), A194 (≠ S193), H220 (= H220), K221 (= K221)
3pgyB Serine hydroxymethyltransferase from staphylococcus aureus, s95p mutant.
36% identity, 90% coverage: 11:374/406 of query aligns to 15:378/404 of 3pgyB
Sites not aligning to the query:
7x5nA Crystal structure of e. Faecium shmt in complex with (+)-shin-1 and plp-ser (see paper)
36% identity, 91% coverage: 21:390/406 of query aligns to 23:407/409 of 7x5nA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: E51 (≠ M49), Y58 (≠ A56), Y59 (= Y57), L115 (≠ V113), G119 (= G117), H120 (= H118), L121 (≠ T119), K340 (≠ R333), N341 (≠ C334), S342 (≠ L335), P350 (≠ E340), F351 (≠ G341), R357 (= R347)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: S29 (= S27), Y49 (= Y47), E51 (≠ M49), Y59 (= Y57), S91 (= S89), G92 (= G90), S93 (≠ T91), H120 (= H118), S170 (= S166), D195 (= D191), A197 (≠ S193), H198 (= H194), K224 (= K221), R357 (= R347)
7v3dA Complex structure of serine hydroxymethyltransferase from enterococcus faecium and its inhibitor (see paper)
36% identity, 91% coverage: 21:390/406 of query aligns to 23:407/409 of 7v3dA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: E51 (≠ M49), Y58 (≠ A56), L115 (≠ V113), G119 (= G117), H120 (= H118), L121 (≠ T119), K340 (≠ R333), S342 (≠ L335), P350 (≠ E340), F351 (≠ G341), R357 (= R347)
- binding pyridoxal-5'-phosphate: Y49 (= Y47), S91 (= S89), G92 (= G90), S93 (≠ T91), H120 (= H118), S170 (= S166), D195 (= D191), A197 (≠ S193), K224 (= K221), G255 (≠ S251)
7x5oB Crystal structure of e. Faecium shmt in complex with me-thf and plp- gly (see paper)
36% identity, 91% coverage: 21:390/406 of query aligns to 24:408/412 of 7x5oB
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: S30 (= S27), Y50 (= Y47), Y60 (= Y57), S92 (= S89), G93 (= G90), S94 (≠ T91), H121 (= H118), S171 (= S166), D196 (= D191), A198 (≠ S193), H199 (= H194), K225 (= K221), R358 (= R347)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: E52 (≠ M49), Y59 (≠ A56), L116 (≠ V113), G119 (= G116), G120 (= G117), H121 (= H118), S171 (= S166), P252 (= P247), N342 (≠ C334), P351 (≠ E340)
1dfoB Crystal structure at 2.4 angstrom resolution of e. Coli serine hydroxymethyltransferase in complex with glycine and 5-formyl tetrahydrofolate (see paper)
34% identity, 92% coverage: 6:378/406 of query aligns to 14:394/417 of 1dfoB
- active site: Y55 (= Y47), E57 (≠ M49), D200 (= D191), T226 (≠ S218), K229 (= K221), R235 (≠ Q227)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: E57 (≠ M49), Y64 (≠ A56), Y65 (= Y57), L121 (≠ V113), G125 (= G117), H126 (= H118), L127 (≠ T119), S175 (= S166), S245 (vs. gap), E247 (= E236), N347 (≠ C334), S355 (= S343), P356 (vs. gap), F357 (vs. gap)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: S35 (= S27), Y55 (= Y47), Y65 (= Y57), S97 (= S89), G98 (= G90), S99 (≠ T91), H126 (= H118), F174 (≠ A165), S175 (= S166), D200 (= D191), A202 (≠ S193), H203 (= H194), K229 (= K221), G262 (≠ S251), R363 (= R347)
Query Sequence
>WP_013683034.1 NCBI__GCF_000194625.1:WP_013683034.1
MREFEQVFSIIEEHHRLMASSLPLIASENVTSMAVRRCYTSDLGHRYAMGEIGERAYEGC
EYIDEIERKAVELTKRLFNAEHANVRPISGTVANIAVYHALTSCGDSIFSLPVECGGHTS
HDDTARIRCLNVHFLPFDSERFNIDIDAASRMIREVKPRLIVLGASVFLFPHPVKEIVEI
AAEVGANVIYDASHVLGLIAGKQFQDPVKEGADVVTASTHKTFFGPQRAIILCKSELAEK
IDYAVMPCVVSNHHLNTLAGYVIACLEMLEFGESYAKQTVRNAKRLAERLYELGMKVVGE
AEGFTESHQVVIDVDDGEKAAKTLEKAGIITNRCLLPWSEGKSAGIRIGVQEVTRLGMKG
GEMEYIAELISKALDGIDVRSEVVELSKQFNTVKYTFEESHAYSFI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory