Comparing WP_013683759.1 NCBI__GCF_000194625.1:WP_013683759.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8TPT4 L-aspartate semialdehyde sulfurtransferase; EC 2.8.1.16 from Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) (see 2 papers)
57% identity, 100% coverage: 2:490/490 of query aligns to 4:498/500 of Q8TPT4
Q57564 L-aspartate semialdehyde sulfurtransferase; EC 2.8.1.16 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
56% identity, 100% coverage: 1:488/490 of query aligns to 3:505/509 of Q57564
3kpcA Crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine (see paper)
53% identity, 24% coverage: 371:488/490 of query aligns to 2:120/124 of 3kpcA
3lfzA Crystal structure of protein mj1225 from methanocaldococcus jannaschii, a putative archaeal homolog of g-ampk. (see paper)
38% identity, 21% coverage: 386:486/490 of query aligns to 163:277/280 of 3lfzA
Sites not aligning to the query:
5g5xA Cbs domain tandem of site-2 protease from archaeoglobus fulgidus in complex with llama nanobody - nucleotide-bound form (see paper)
34% identity, 22% coverage: 379:487/490 of query aligns to 6:110/119 of 5g5xA
2yzqA Crystal structure of uncharacterized conserved protein from pyrococcus horikoshii
44% identity, 17% coverage: 405:489/490 of query aligns to 138:224/224 of 2yzqA
P9WKI7 Inosine-5'-monophosphate dehydrogenase; IMP dehydrogenase; IMPD; IMPDH; IMPDH2; EC 1.1.1.205 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 22% coverage: 377:486/490 of query aligns to 129:238/529 of P9WKI7
Sites not aligning to the query:
4gqyA Crystal structure of cbsx2 in complex with amp (see paper)
31% identity, 22% coverage: 374:480/490 of query aligns to 4:134/147 of 4gqyA
7pjiA Crystal structure of pseudomonas aeruginosa guab (imp dehydrogenase) bound to atp and gdp at 1.65a resolution (see paper)
31% identity, 26% coverage: 359:486/490 of query aligns to 79:202/445 of 7pjiA
Sites not aligning to the query:
7qemB Bacterial impdh chimera (see paper)
32% identity, 24% coverage: 368:486/490 of query aligns to 86:204/428 of 7qemB
Sites not aligning to the query:
P0C0H6 Inosine-5'-monophosphate dehydrogenase; IMP dehydrogenase; IMPD; IMPDH; EC 1.1.1.205 from Streptococcus pyogenes (see paper)
30% identity, 21% coverage: 384:488/490 of query aligns to 104:210/493 of P0C0H6
Sites not aligning to the query:
1zfjA Inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes (see paper)
30% identity, 21% coverage: 384:488/490 of query aligns to 103:209/476 of 1zfjA
Sites not aligning to the query:
6gk9A Inhibited structure of impdh from pseudomonas aeruginosa (see paper)
30% identity, 26% coverage: 361:486/490 of query aligns to 82:197/424 of 6gk9A
7qdxA Bacterial impdh chimera (see paper)
33% identity, 24% coverage: 368:486/490 of query aligns to 81:198/402 of 7qdxA
4fryB The structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 (see paper)
32% identity, 22% coverage: 383:489/490 of query aligns to 20:129/138 of 4fryB
Sites not aligning to the query:
4z87A Structure of the imp dehydrogenase from ashbya gossypii bound to gdp (see paper)
30% identity, 25% coverage: 366:486/490 of query aligns to 107:229/498 of 4z87A
Sites not aligning to the query:
7oj1B Bacillus subtilis impdh in complex with ap4a (see paper)
27% identity, 23% coverage: 375:488/490 of query aligns to 94:208/425 of 7oj1B
5tc3A Structure of imp dehydrogenase from ashbya gossypii bound to atp and gdp (see paper)
30% identity, 25% coverage: 366:486/490 of query aligns to 107:229/488 of 5tc3A
Sites not aligning to the query:
5mcpC Structure of imp dehydrogenase from ashbya gossypii bound to atp (see paper)
30% identity, 25% coverage: 366:486/490 of query aligns to 110:232/446 of 5mcpC
Sites not aligning to the query:
5x9gA Crystal structure of the cytosolic domain of the mg2+ channel mgte in complex with atp (see paper)
40% identity, 16% coverage: 411:488/490 of query aligns to 174:248/248 of 5x9gA
Sites not aligning to the query:
>WP_013683759.1 NCBI__GCF_000194625.1:WP_013683759.1
MKTVEEINERIREGNVCVVTASEMKELVAELGAEKAAKEVDVVTTGTFGAMCSSGVFMNF
GHSDPPIKMQKIWLNDVEAYTGIAAVDAYLGVTQVSEKHEEYGGAHVIEELVRGREVVLR
AISKGTDCYPRKEIITEIALEDLNQAEMLNPRNAYQRYKAATNSSQQLLRTYMGTLLPNF
GNVTFAGCGEISPLNNDPEYRTIGVGTRIFLCGAKGYVIGEGTQHCPPFGTLMVKGNLKE
MKPEFMRAAVFPGYGVTMYVGIGIPIPILDADMARATAIRDEEIWTEIIDFGVPRRQRPV
VKKVNYAELKSGKVEINGEEVRVSPLSSFYMAEKIMEELKRQIERAEFFLSPPAERISRE
CNFKPMRQREVKFVRSVMTPAITIEPETSVDEASRIMIQKGVNHLPVVKDGRLVGIVTSW
DIAKAVATKKTGNVAEIMTRKVITALPDEPVEIAARKMEKHNISALPVVDAKQRVIGMVT
SEDLSKLLVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory