SitesBLAST
Comparing WP_013684029.1 NCBI__GCF_000194625.1:WP_013684029.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6hulB Sulfolobus solfataricus tryptophan synthase ab complex (see paper)
56% identity, 96% coverage: 13:427/434 of query aligns to 2:414/416 of 6hulB
- binding pyridoxal-5'-phosphate: H103 (= H113), K104 (= K114), Q131 (= Q141), S220 (= S231), G255 (= G266), G256 (= G267), G257 (= G268), S258 (= S269), N259 (= N270), E371 (= E384), S400 (= S413), G401 (= G414)
- binding serine: K104 (= K114), T127 (= T137), G128 (= G138), A129 (= A139), G130 (= G140), W132 (= W142)
4qysB Trpb2 enzymes (see paper)
47% identity, 97% coverage: 7:428/434 of query aligns to 3:417/418 of 4qysB
- active site: K101 (= K114), E123 (= E136), S402 (= S413)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: H100 (= H113), K101 (= K114), G252 (= G266), G253 (= G267), G254 (= G268), S255 (= S269), N256 (= N270), E373 (= E384), S402 (= S413)
4qysA Trpb2 enzymes (see paper)
47% identity, 97% coverage: 7:428/434 of query aligns to 3:407/408 of 4qysA
- active site: K108 (= K114), E130 (= E136), S392 (= S413)
- binding pyridoxal-5'-phosphate: H107 (= H113), K108 (= K114), G242 (= G266), G243 (= G267), G244 (= G268), S245 (= S269), N246 (= N270), E363 (= E384), S392 (= S413)
- binding phosphoserine: K108 (= K114), G132 (= G138), A133 (= A139), Q135 (= Q141), W136 (= W142), G316 (= G337), R318 (= R339), E363 (= E384)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
38% identity, 79% coverage: 80:420/434 of query aligns to 49:376/383 of 5vm5D
- active site: K82 (= K114), E104 (= E136), S369 (= S413)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H113), K82 (= K114), T105 (= T137), G106 (= G138), A107 (= A139), Q109 (= Q141), H110 (≠ W142), S185 (= S231), G227 (= G266), G229 (= G268), S230 (= S269), N231 (= N270), G296 (= G337), E343 (= E384), S369 (= S413)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
38% identity, 79% coverage: 80:420/434 of query aligns to 49:377/383 of 5dw3A
- active site: K82 (= K114), E104 (= E136), S370 (= S413)
- binding tryptophan: K82 (= K114), E104 (= E136), T105 (= T137), G106 (= G138), A107 (= A139), Q109 (= Q141), H110 (≠ W142), S185 (= S231), G228 (= G267), Y300 (= Y340)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
38% identity, 79% coverage: 80:420/434 of query aligns to 49:376/394 of 5ixjD
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
38% identity, 79% coverage: 80:420/434 of query aligns to 49:378/384 of 7rnpA
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
38% identity, 79% coverage: 80:420/434 of query aligns to 49:376/383 of 5t6mA
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
38% identity, 79% coverage: 80:420/434 of query aligns to 49:378/385 of 6am8B
- active site: K82 (= K114), E104 (= E136), S371 (= S413)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H113), K82 (= K114), E104 (= E136), T105 (= T137), G106 (= G138), A107 (= A139), Q109 (= Q141), H110 (≠ W142), L161 (= L198), S185 (= S231), V187 (≠ L233), G227 (= G266), G228 (= G267), G229 (= G268), S230 (= S269), N231 (= N270), G298 (= G337), Y301 (= Y340), E345 (= E384), S371 (= S413), G372 (= G414)
- binding tryptophan: L169 (≠ V216), S274 (≠ T316), H275 (≠ P317)
Sites not aligning to the query:
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
38% identity, 79% coverage: 80:420/434 of query aligns to 49:378/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
38% identity, 79% coverage: 80:420/434 of query aligns to 49:378/386 of 1v8zA
- active site: K82 (= K114), E104 (= E136), S371 (= S413)
- binding pyridoxal-5'-phosphate: H81 (= H113), K82 (= K114), Q109 (= Q141), S185 (= S231), G227 (= G266), G228 (= G267), G229 (= G268), S230 (= S269), N231 (= N270), E345 (= E384), S371 (= S413), G372 (= G414)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
38% identity, 79% coverage: 80:420/434 of query aligns to 49:378/388 of 5dw0A
- active site: K82 (= K114), E104 (= E136), S371 (= S413)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H113), K82 (= K114), T105 (= T137), G106 (= G138), A107 (= A139), Q109 (= Q141), H110 (≠ W142), S185 (= S231), G227 (= G266), G229 (= G268), S230 (= S269), N231 (= N270), G298 (= G337), D300 (≠ R339), E345 (= E384), S371 (= S413)
5ey5B Lbcats
35% identity, 79% coverage: 78:420/434 of query aligns to 47:378/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H113), K82 (= K114), Q109 (= Q141), S185 (= S231), G227 (= G266), G229 (= G268), S230 (= S269), N231 (= N270), E345 (= E384), S371 (= S413), G372 (= G414)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
37% identity, 79% coverage: 80:420/434 of query aligns to 49:378/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H113), K82 (= K114), T105 (= T137), G106 (= G138), A107 (= A139), Q109 (= Q141), H110 (≠ W142), S185 (= S231), G227 (= G266), G229 (= G268), S230 (= S269), N231 (= N270), G298 (= G337), E345 (= E384), S371 (= S413)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
37% identity, 79% coverage: 80:420/434 of query aligns to 49:378/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H113), K82 (= K114), T105 (= T137), G106 (= G138), A107 (= A139), Q109 (= Q141), H110 (≠ W142), S185 (= S231), G227 (= G266), G229 (= G268), S230 (= S269), N231 (= N270), G298 (= G337), E345 (= E384), S371 (= S413)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
30% identity, 90% coverage: 30:420/434 of query aligns to 26:393/404 of 6usaB
- active site: K97 (= K114), E119 (= E136), S386 (= S413)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H113), K97 (= K114), T120 (= T137), G121 (= G138), A122 (= A139), G123 (= G140), Q124 (= Q141), H125 (≠ W142), T200 (≠ S231), G242 (= G266), G244 (= G268), S245 (= S269), N246 (= N270), G313 (= G337), E360 (= E384), S386 (= S413)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ V216), W187 (vs. gap), Y196 (= Y227), F198 (≠ L229), G203 (≠ N234), P204 (vs. gap), F207 (vs. gap), H290 (≠ V313), G291 (= G314)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
30% identity, 90% coverage: 30:420/434 of query aligns to 26:393/404 of 6dweB
- active site: K97 (= K114), E119 (= E136), S386 (= S413)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ V216), Y196 (= Y227), F198 (≠ L229), P204 (vs. gap), F207 (vs. gap), H290 (≠ V313)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H113), K97 (= K114), T120 (= T137), G121 (= G138), A122 (= A139), G123 (= G140), Q124 (= Q141), H125 (≠ W142), T200 (≠ S231), G242 (= G266), G244 (= G268), S245 (= S269), N246 (= N270), G313 (= G337), E360 (= E384), S386 (= S413)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
30% identity, 90% coverage: 30:420/434 of query aligns to 27:394/405 of 6u6cB
- active site: K98 (= K114), E120 (= E136), S387 (= S413)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H113), K98 (= K114), T121 (= T137), G122 (= G138), A123 (= A139), Q125 (= Q141), H126 (≠ W142), T201 (≠ S231), G243 (= G266), G245 (= G268), S246 (= S269), N247 (= N270), G314 (= G337), E361 (= E384), S387 (= S413)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: F185 (≠ V216), W188 (vs. gap), Y197 (= Y227), F199 (≠ L229), G204 (≠ N234), P205 (vs. gap), H291 (≠ V313), G292 (= G314)
Sites not aligning to the query:
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
30% identity, 90% coverage: 30:420/434 of query aligns to 27:394/406 of 5tciH
- active site: K98 (= K114), E120 (= E136), S387 (= S413)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (= P31), L31 (= L34), Y197 (= Y227), F199 (≠ L229), P205 (vs. gap), F208 (vs. gap), H291 (≠ V313)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
30% identity, 90% coverage: 30:420/434 of query aligns to 26:393/405 of 6uapB
- active site: K97 (= K114), E119 (= E136), S386 (= S413)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (= I212), N181 (≠ S213), F184 (≠ V216), Y196 (= Y227), F198 (≠ L229), P204 (vs. gap), F207 (vs. gap), H290 (≠ V313)
Query Sequence
>WP_013684029.1 NCBI__GCF_000194625.1:WP_013684029.1
MSFDGRKVILDPEEMPREWYNILPDLPKPLPPPLHPVTKEPIKPSDLEPIFPKELIKQEM
SDERWIRIPEEVLEVYRLWRPTPLIRAKRLEEALKTPAKIYYKYEGVSPPGSHKPNTAVA
QAYYNMKEGVERLTTETGAGQWGSALSFATRLFDMKCTVYMVKVSYHQKPYRRILMETWG
GEVIPSPSDRTESGRRILEKDPDNTGSLGIAISEAVEDAAKHENTNYSLGSVLNHVLLHQ
TIIGLEAKKQFELIDEKPDVLIGCVGGGSNFAGFCYPFIKDAEKEGIRIVAVEPAACPTL
TAGEYRYDYGDTVGLTPLLMMYTLGHDFMPPPIHAGGLRYHGDAPTLSLLVAEGVIEAVA
VKQIPTFEAGLLFARTEGIVPAPESNHAIRVAIDEALKAKEEGEEKVIAFNLSGHGYFDL
AAYDDYLYGRLKDT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory