Comparing WP_013684075.1 NCBI__GCF_000194625.1:WP_013684075.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
1hg3A Crystal structure of tetrameric tim from pyrococcus woesei. (see paper)
56% identity, 86% coverage: 33:247/250 of query aligns to 7:221/224 of 1hg3A
P62003 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Pyrococcus woesei (see 2 papers)
56% identity, 86% coverage: 33:247/250 of query aligns to 8:222/228 of P62003
Sites not aligning to the query:
Q8NKN9 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1) (see paper)
48% identity, 86% coverage: 33:246/250 of query aligns to 5:218/226 of Q8NKN9
1w0mA Triosephosphate isomerase from thermoproteus tenax (see paper)
48% identity, 86% coverage: 33:246/250 of query aligns to 5:218/225 of 1w0mA
5csrC Crystal structure of triosephosphate isomerase from thermoplasma acidophilium (see paper)
35% identity, 88% coverage: 31:250/250 of query aligns to 1:216/220 of 5csrC
5cssA Crystal structure of triosephosphate isomerase from thermoplasma acidophilum with glycerol 3-phosphate (see paper)
35% identity, 87% coverage: 31:247/250 of query aligns to 1:213/214 of 5cssA
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
31% identity, 51% coverage: 67:193/250 of query aligns to 38:191/255 of 4mvaA
Sites not aligning to the query:
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
31% identity, 51% coverage: 67:193/250 of query aligns to 38:191/255 of B1XB85
Sites not aligning to the query:
1aw1A Triosephosphate isomerase of vibrio marinus complexed with 2- phosphoglycolate (see paper)
31% identity, 51% coverage: 67:194/250 of query aligns to 37:193/255 of 1aw1A
Sites not aligning to the query:
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
31% identity, 51% coverage: 67:194/250 of query aligns to 38:194/256 of P50921
Sites not aligning to the query:
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 50% coverage: 27:151/250 of query aligns to 397:529/654 of P36204
Sites not aligning to the query:
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
29% identity, 52% coverage: 47:177/250 of query aligns to 13:174/251 of 1btmA
Sites not aligning to the query:
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
29% identity, 52% coverage: 47:177/250 of query aligns to 14:175/253 of P00943
Sites not aligning to the query:
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
25% identity, 68% coverage: 67:235/250 of query aligns to 43:244/255 of 6ooiC
Sites not aligning to the query:
4y90A Crystal structure of triosephosphate isomerase from deinococcus radiodurans (see paper)
33% identity, 33% coverage: 67:148/250 of query aligns to 37:124/244 of 4y90A
Sites not aligning to the query:
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
34% identity, 33% coverage: 67:148/250 of query aligns to 39:128/252 of 6neeB
Sites not aligning to the query:
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
22% identity, 77% coverage: 44:235/250 of query aligns to 13:237/248 of 5zfxB
Sites not aligning to the query:
>WP_013684075.1 NCBI__GCF_000194625.1:WP_013684075.1
MLSVVCSFFHGDNPNWGLEKIKFPTKKRKIMGVVIINFKAYREGSGKQALELAKIAENVA
SRVDDYIAIAPPTIDLAEIINAVSIDVYAQHVDAVDFGSHTGRITAEMVKEKGAKGSLIN
HSERRLRLADIDFLVSKFKELGLVSIVCTNNVATTAAAAALNPDYVAVEPPELIGSGIPV
SKAEPETVENSVKAAKDVNPNVKVLCGAGIGRHEDYVTALDLGADGVLLASGIVKAKDPK
AALEELVGLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory