Comparing WP_013706794.1 NCBI__GCF_000195295.1:WP_013706794.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
45% identity, 97% coverage: 7:259/260 of query aligns to 10:262/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
45% identity, 97% coverage: 7:259/260 of query aligns to 6:258/267 of P0ADG4
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
44% identity, 97% coverage: 7:259/260 of query aligns to 6:258/262 of 2qflA
6tqoT Rrn anti-termination complex (see paper)
44% identity, 97% coverage: 7:259/260 of query aligns to 6:250/255 of 6tqoT
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 100% coverage: 2:260/260 of query aligns to 7:268/271 of Q9M8S8
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
40% identity, 98% coverage: 5:259/260 of query aligns to 3:255/258 of 3lv0A
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
39% identity, 98% coverage: 5:259/260 of query aligns to 3:237/238 of 3luzA
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
40% identity, 99% coverage: 3:259/260 of query aligns to 17:278/288 of O14732
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
39% identity, 98% coverage: 5:259/260 of query aligns to 5:233/234 of 3luzB
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
40% identity, 99% coverage: 3:259/260 of query aligns to 3:255/259 of 2cziA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
35% identity, 95% coverage: 15:260/260 of query aligns to 18:268/277 of P20456
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
35% identity, 95% coverage: 15:260/260 of query aligns to 16:266/274 of 2bjiA
2p3nA Thermotoga maritima impase tm1415 (see paper)
39% identity, 91% coverage: 15:251/260 of query aligns to 13:239/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
39% identity, 91% coverage: 15:251/260 of query aligns to 13:239/256 of O33832
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
33% identity, 100% coverage: 2:260/260 of query aligns to 5:264/266 of 1imdA
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
33% identity, 100% coverage: 2:260/260 of query aligns to 5:264/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
33% identity, 100% coverage: 2:260/260 of query aligns to 5:264/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
33% identity, 100% coverage: 2:260/260 of query aligns to 5:264/272 of 1awbA
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
33% identity, 100% coverage: 2:260/260 of query aligns to 9:268/277 of P29218
6giuA Human impase with l-690330 (see paper)
33% identity, 100% coverage: 2:260/260 of query aligns to 7:266/275 of 6giuA
>WP_013706794.1 NCBI__GCF_000195295.1:WP_013706794.1
MLDQIQQIARQAALKAGALLRRNFAQPHKITLKGRHDPVTESDLQSQEIIVQTLLQVFPN
HHILAEEQGAPNSAKSSQDNCWIIDPLDGTVNFAHGFPMFAVSIAFQQQGAVLYGVVYDP
MREELFEAARGRGAWLNRQPIRVSTVRELDQALVATGFPYNVNERLENTIRRFKKLVALA
EGVRRPGSAALDLSCLAAGRFDGFWEEGLKPWDTAAAVLIVEEAGGRVSNFGGGPFDLAS
DNVAASNGLLHRQLLQALQI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory