SitesBLAST
Comparing WP_013707105.1 NCBI__GCF_000195295.1:WP_013707105.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q96XT4 2-oxoacid:ferredoxin oxidoreductase 2, subunit beta; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
47% identity, 86% coverage: 15:258/284 of query aligns to 11:268/304 of Q96XT4
- C12 (= C16) binding [4Fe-4S] cluster
- C15 (= C19) binding [4Fe-4S] cluster
- IGCS 44:47 (≠ IGQA 48:51) binding thiamine diphosphate
- C46 (≠ Q50) binding [4Fe-4S] cluster
- D90 (= D92) binding Mg(2+)
- GD 91:92 (≠ GC 93:94) binding thiamine diphosphate
- N118 (= N120) binding Mg(2+)
- V120 (= V122) binding Mg(2+)
- GL 122:123 (= GL 124:125) binding thiamine diphosphate
- C197 (= C199) binding [4Fe-4S] cluster
5b46B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
47% identity, 86% coverage: 15:258/284 of query aligns to 8:265/301 of 5b46B
- binding magnesium ion: D87 (= D92), N115 (= N120), V117 (= V122)
- binding iron/sulfur cluster: W8 (= W15), C9 (= C16), C12 (= C19), C43 (≠ Q50), C194 (= C199), T196 (≠ S201), Y197 (≠ F202)
- binding thiamine diphosphate: I41 (= I48), G42 (= G49), C43 (≠ Q50), S44 (≠ A51), H62 (= H67), G86 (= G91), G88 (= G93), D89 (≠ C94), N115 (= N120), V117 (= V122), Y118 (= Y123), G119 (= G124), L120 (= L125), T121 (= T126)
P72579 2-oxoacid:ferredoxin oxidoreductase subunit beta; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see paper)
43% identity, 94% coverage: 15:280/284 of query aligns to 11:295/305 of P72579
- K49 (= K53) mutation to I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to R: Increase the oxidoreductase activity with pyruvate.; mutation to V: Slight decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.
- L123 (= L125) mutation L->A,I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to N: Strong decrease of the oxidoreductase activity with pyruvate and 2-oxobutyrate. However, this mutant shows almost the same activity with 2-oxoglutarate as the wild-type.
Q96Y68 2-oxoacid:ferredoxin oxidoreductase 1, subunit beta; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 2 papers)
43% identity, 94% coverage: 15:280/284 of query aligns to 11:295/305 of Q96Y68
- C12 (= C16) binding [4Fe-4S] cluster
- C15 (= C19) binding [4Fe-4S] cluster
- C46 (≠ Q50) binding [4Fe-4S] cluster
- K49 (= K53) mutation to I: Loss of oxidoreductase activity toward 2-oxoglutarate but retains its activity toward pyruvate.
- D90 (= D92) binding Mg(2+)
- GD 91:92 (≠ GC 93:94) binding thiamine diphosphate
- N118 (= N120) binding Mg(2+)
- V120 (= V122) binding Mg(2+)
- GL 122:123 (= GL 124:125) binding thiamine diphosphate
- K125 (= K127) Plays an important role in the binding of CoA; mutation to A: Shows a strong decrease of affinity for CoA and a poor inactivation by 4-fluoro-7-nitrobenzofurazan (NBD-F).
- K173 (≠ D175) mutation to A: Same oxidoreductase activity as the wild-type.
- C197 (= C199) binding [4Fe-4S] cluster
5b48B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
42% identity, 94% coverage: 15:280/284 of query aligns to 7:277/286 of 5b48B
- binding magnesium ion: D84 (= D92), N112 (= N120), V114 (= V122)
- binding iron/sulfur cluster: C8 (= C16), C11 (= C19), C42 (≠ Q50), C183 (= C199), T185 (≠ S201)
- binding 2-[(2E)-3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-(1-oxidanylpropylidene)-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: I40 (= I48), G41 (= G49), C42 (≠ Q50), S43 (≠ A51), H59 (= H67), G85 (= G93), D86 (≠ C94), N112 (= N120), V114 (= V122), Y115 (= Y123), G116 (= G124), L117 (= L125)
5b47B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
44% identity, 85% coverage: 15:255/284 of query aligns to 4:236/275 of 5b47B
- binding magnesium ion: D83 (= D92), N111 (= N120)
- binding iron/sulfur cluster: C5 (= C16), C8 (= C19), C39 (≠ Q50), C179 (= C199)
- binding thiamine diphosphate: I37 (= I48), G38 (= G49), C39 (≠ Q50), S40 (≠ A51), H58 (= H67), G84 (= G93), D85 (≠ C94), N111 (= N120), V113 (= V122), Y114 (= Y123), L116 (= L125)
6n2oD 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
36% identity, 87% coverage: 13:258/284 of query aligns to 22:267/291 of 6n2oD
- binding magnesium ion: D101 (= D92), N129 (= N120), I131 (≠ V122)
- binding succinyl-coenzyme a: I57 (= I48), R62 (≠ K53), L134 (= L125), K136 (= K127)
- binding iron/sulfur cluster: W24 (= W15), C25 (= C16), C28 (= C19), C59 (≠ Q50), C208 (= C199), T210 (≠ S201), F211 (= F202)
- binding thiamine diphosphate: I57 (= I48), G58 (= G49), C59 (≠ Q50), S60 (≠ A51), H76 (= H67), G102 (= G93), D103 (≠ C94), N129 (= N120), I131 (≠ V122), G133 (= G124), L134 (= L125), T135 (= T126)
6n2oB 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
36% identity, 87% coverage: 13:258/284 of query aligns to 22:267/291 of 6n2oB
- binding 2-oxoglutaric acid: R62 (≠ K53), L134 (= L125)
- binding coenzyme a: K136 (= K127), Y150 (≠ K141)
- binding magnesium ion: D101 (= D92), N129 (= N120), I131 (≠ V122)
- binding iron/sulfur cluster: W24 (= W15), C25 (= C16), C28 (= C19), C59 (≠ Q50), C208 (= C199), T210 (≠ S201), F211 (= F202)
- binding thiamine diphosphate: I57 (= I48), G58 (= G49), C59 (≠ Q50), S60 (≠ A51), H76 (= H67), G102 (= G93), D103 (≠ C94), N129 (= N120), I131 (≠ V122), Y132 (= Y123), G133 (= G124), L134 (= L125), T135 (= T126)
6n2nB Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
36% identity, 87% coverage: 13:258/284 of query aligns to 22:267/291 of 6n2nB
- binding magnesium ion: D101 (= D92), N129 (= N120), I131 (≠ V122)
- binding iron/sulfur cluster: W24 (= W15), C25 (= C16), C28 (= C19), H30 (≠ N21), C59 (≠ Q50), C208 (= C199), T210 (≠ S201), F211 (= F202)
- binding thiamine diphosphate: I57 (= I48), G58 (= G49), C59 (≠ Q50), S60 (≠ A51), H76 (= H67), G100 (= G91), D101 (= D92), G102 (= G93), D103 (≠ C94), N129 (= N120), I131 (≠ V122), Y132 (= Y123), G133 (= G124), L134 (= L125), T135 (= T126)
8x3zB Thdp-dependent hka synthase
26% identity, 50% coverage: 53:195/284 of query aligns to 382:502/511 of 8x3zB
- binding adenosine-5'-diphosphate: H392 (≠ F63)
- binding magnesium ion: D421 (= D92), N448 (= N120), R450 (≠ V122)
- binding thiamine diphosphate: M396 (≠ H67), G420 (= G91), D421 (= D92), G422 (= G93), C423 (= C94), N448 (= N120), R450 (≠ V122), L451 (≠ Y123), G452 (= G124)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 88, 90, 206, 207, 208, 230, 232, 272, 273, 274, 297, 298, 316, 317
- binding thiamine diphosphate: 368, 370
Query Sequence
>WP_013707105.1 NCBI__GCF_000195295.1:WP_013707105.1
MMLSESIYGNYETAWCPGCGNFRILAALKKALVESNLTPHEVIFVSGIGQAAKTPHYLNA
NLFNGLHGRSLPVATGCRLANHQMPVIVETGDGCTYGEGGNHFLAAIRRNINITLLVHNN
QVYGLTKGQASPTSDEGFITKAQPHGVYAAAFNPIAVAVALHAGFVARSFAGFEDHLTEM
IKQAISHPGFALVDILQPCVSFNKVNTFAWYKNRCYRLPETYDPTDWSAAILKANEWGDQ
IPLGVISKNSRPPFEAHFDCLGHTPLARQQVDKAKLKAFITHYR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory