Comparing WP_013707419.1 NCBI__GCF_000195295.1:WP_013707419.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
49% identity, 100% coverage: 1:290/290 of query aligns to 1:294/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
49% identity, 100% coverage: 1:290/290 of query aligns to 2:295/295 of 1o5kA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
50% identity, 100% coverage: 1:290/290 of query aligns to 1:291/292 of Q07607
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
55% identity, 100% coverage: 1:290/290 of query aligns to 1:291/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
55% identity, 100% coverage: 1:290/290 of query aligns to 1:291/292 of 3puoA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
51% identity, 100% coverage: 2:290/290 of query aligns to 2:291/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
51% identity, 100% coverage: 2:290/290 of query aligns to 2:291/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
51% identity, 100% coverage: 2:290/290 of query aligns to 2:291/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
51% identity, 100% coverage: 2:290/290 of query aligns to 2:291/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
51% identity, 100% coverage: 2:290/290 of query aligns to 2:291/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
51% identity, 100% coverage: 2:290/290 of query aligns to 2:291/291 of 3pueB
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
49% identity, 100% coverage: 1:290/290 of query aligns to 2:293/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
49% identity, 100% coverage: 1:290/290 of query aligns to 1:292/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
49% identity, 100% coverage: 1:290/290 of query aligns to 1:292/292 of P0A6L2
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
48% identity, 100% coverage: 1:290/290 of query aligns to 1:292/292 of 3i7sA
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
48% identity, 100% coverage: 1:290/290 of query aligns to 1:293/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
48% identity, 100% coverage: 1:290/290 of query aligns to 1:293/294 of Q8UGL3
4pfmA Shewanella benthica dhdps with lysine and pyruvate
48% identity, 99% coverage: 1:286/290 of query aligns to 2:289/295 of 4pfmA
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
45% identity, 100% coverage: 1:289/290 of query aligns to 3:293/296 of 4m19A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
44% identity, 100% coverage: 1:289/290 of query aligns to 3:293/296 of 6u01B
>WP_013707419.1 NCBI__GCF_000195295.1:WP_013707419.1
MIQGAIVAIVTPFKDGQLDEETYRELIEFQIAGGTHGIVPCGTTGESATLSHHEHKRVVE
ICIEQVKKRVPVIAGTGSNNTAEAVELTKHAQSAGADAALMITPYYNKPTQEGLYQHYKA
IAEATHIPIIVYNVPGRTSLNLLPETVARLAKLPNIIGIKEATGDLNQGARVIRLCPENF
IVLSGDDFTALPLMCLGGRGVISVISNVVPDDMAGMCNAFLSGNLGTARSLHYKMWPLME
AMFFETNPVPAKTALKLMGRISGEVRLPLCNMSPANEERLRQVMVNYGLI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory