Comparing WP_013707681.1 NCBI__GCF_000195295.1:WP_013707681.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
33% identity, 95% coverage: 1:200/211 of query aligns to 1:200/207 of 4ij6A
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
33% identity, 94% coverage: 2:200/211 of query aligns to 2:201/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
33% identity, 94% coverage: 2:200/211 of query aligns to 2:201/207 of 1h2eA
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
25% identity, 95% coverage: 1:200/211 of query aligns to 1:196/196 of 6m1xC
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
25% identity, 95% coverage: 1:200/211 of query aligns to 1:196/198 of 5zr2C
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 76% coverage: 4:164/211 of query aligns to 10:177/211 of P36623
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
27% identity, 83% coverage: 1:176/211 of query aligns to 1:208/247 of P00950
3gp5A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate (see paper)
39% identity, 48% coverage: 1:102/211 of query aligns to 1:107/248 of 3gp5A
Sites not aligning to the query:
3gp3A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 2-phosphoserine (see paper)
39% identity, 48% coverage: 1:102/211 of query aligns to 1:107/229 of 3gp3A
Sites not aligning to the query:
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
39% identity, 48% coverage: 1:102/211 of query aligns to 1:107/230 of 3fdzA
Sites not aligning to the query:
Q3JWH7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Burkholderia pseudomallei (strain 1710b) (see paper)
39% identity, 48% coverage: 1:102/211 of query aligns to 1:107/249 of Q3JWH7
Sites not aligning to the query:
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
27% identity, 82% coverage: 3:176/211 of query aligns to 2:207/234 of 5pgmE
Sites not aligning to the query:
1bq4A Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate (see paper)
27% identity, 82% coverage: 3:176/211 of query aligns to 2:207/234 of 1bq4A
1bq3A Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate (see paper)
27% identity, 82% coverage: 3:176/211 of query aligns to 2:207/234 of 1bq3A
1qhfA Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a (see paper)
27% identity, 82% coverage: 3:176/211 of query aligns to 2:207/240 of 1qhfA
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
36% identity, 51% coverage: 1:107/211 of query aligns to 1:113/239 of 1e59A
Sites not aligning to the query:
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
36% identity, 51% coverage: 1:107/211 of query aligns to 3:115/250 of P62707
Sites not aligning to the query:
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
30% identity, 75% coverage: 4:161/211 of query aligns to 6:166/257 of Q7ZVE3
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
30% identity, 70% coverage: 3:150/211 of query aligns to 5:159/223 of P9WIC7
Sites not aligning to the query:
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
30% identity, 70% coverage: 3:150/211 of query aligns to 3:157/209 of 4qihA
>WP_013707681.1 NCBI__GCF_000195295.1:WP_013707681.1
MTKIILVRHGQTPWNKDKIFRGSKDIPLNEQGREEARLAGEWLQEETIHAAYTSPLSRSR
DTARAIAQHHYVEVQDLPGLTDLCYGDWEGLPLTEVKVNYADLYRQWEATPHMVRFPQGE
TLAEVRGRAWSAVAKVVARHPDETVLLSAHRAVNKVLIAAFIGLDDSHFWRIGQDTTAVN
RFIWTGATWQIISLNDVSHLRGMARGEYVDF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory