SitesBLAST
Comparing WP_013817130.1 NCBI__GCF_000214665.1:WP_013817130.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j40A Crystal structure of catb8 in complex with chloramphenicol (see paper)
53% identity, 38% coverage: 101:168/181 of query aligns to 110:177/209 of 8j40A
Sites not aligning to the query:
- binding chloramphenicol: 7, 8, 9, 29, 31, 47, 50, 90, 187, 190, 191, 202, 203, 206
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
42% identity, 69% coverage: 28:152/181 of query aligns to 74:184/188 of 3igjC
- binding acetyl coenzyme *a: F84 (≠ I39), A106 (≠ S71), Y112 (≠ T77), A114 (≠ S79), H116 (= H81), G142 (= G110), N148 (≠ M116), A160 (= A128), S161 (= S129), T166 (= T134), N178 (≠ V146)
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
35% identity, 72% coverage: 45:175/181 of query aligns to 56:190/204 of 1mrlA
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: I56 (≠ V45), N81 (≠ Y73), H82 (≠ V74), L93 (≠ K85), M102 (vs. gap), L108 (≠ R95)
Sites not aligning to the query:
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: 37, 39, 54
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
35% identity, 72% coverage: 45:175/181 of query aligns to 56:190/203 of 3dhoA
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
35% identity, 72% coverage: 45:175/181 of query aligns to 56:190/205 of 1kk4A
- binding acetyl coenzyme *a: I69 (= I58), G70 (≠ A59), K111 (≠ S98), W121 (≠ L108), G123 (= G110), K124 (≠ H111), A141 (= A128), A142 (≠ S129), V147 (≠ T134), K148 (= K135), L155 (≠ V142), G157 (= G144), G158 (= G145), P160 (= P147), I164 (= I151)
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
35% identity, 72% coverage: 45:175/181 of query aligns to 56:190/209 of P50870
- H82 (≠ V74) mutation to A: 105-fold decrease in activity.
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
35% identity, 72% coverage: 45:175/181 of query aligns to 56:190/206 of 1khrA
- binding coenzyme a: H82 (≠ V74), M84 (≠ I76), W121 (≠ L108), A141 (= A128), A142 (≠ S129), V147 (≠ T134), L155 (≠ V142), G157 (= G144), P160 (= P147), I164 (= I151)
- binding virginiamycin m1: A80 (≠ S72), N81 (≠ Y73), H82 (≠ V74), L93 (≠ K85)
Sites not aligning to the query:
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
62% identity, 32% coverage: 98:155/181 of query aligns to 109:166/210 of 6pubA
Sites not aligning to the query:
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
62% identity, 32% coverage: 98:155/181 of query aligns to 106:163/206 of 6u9cA
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
34% identity, 73% coverage: 28:160/181 of query aligns to 72:190/200 of 1krrA
- binding acetyl coenzyme *a: N84 (≠ R40), I103 (= I58), A104 (= A59), P105 (= P60), T112 (= T77), H114 (≠ S79), G140 (= G110), S141 (≠ H111), N146 (≠ M116), G158 (≠ A128), A159 (≠ S129), A174 (≠ G144), P177 (= P147), R182 (≠ K152)
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
34% identity, 73% coverage: 28:160/181 of query aligns to 72:190/201 of 1krvA
- binding 4-nitrophenyl beta-D-galactopyranoside: Y82 (≠ I38), N84 (≠ R40), V90 (≠ F46), D92 (= D48), M126 (≠ P96)
- binding coenzyme a: A104 (= A59), S110 (≠ A75), T112 (= T77), W138 (≠ L108), G140 (= G110), S141 (≠ H111), N146 (≠ M116), A159 (≠ S129), P177 (= P147), R179 (≠ K149), R182 (≠ K152)
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
34% identity, 73% coverage: 28:160/181 of query aligns to 72:190/201 of 1kruA
- binding coenzyme a: H114 (≠ S79), W138 (≠ L108), G140 (= G110), S141 (≠ H111), G158 (≠ A128), A159 (≠ S129), P177 (= P147), R182 (≠ K152)
- binding 1-methylethyl 1-thio-beta-D-galactopyranoside: Y82 (≠ I38), Y82 (≠ I38), N84 (≠ R40), V90 (≠ F46), D92 (= D48), L102 (≠ E57), H114 (≠ S79), M126 (≠ P96)
Sites not aligning to the query:
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
33% identity, 71% coverage: 42:169/181 of query aligns to 53:178/208 of 2xatA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 73% coverage: 28:160/181 of query aligns to 73:191/203 of P07464
- N85 (≠ R40) binding in other chain; binding in other chain
- D93 (= D48) binding
- H115 (≠ S79) mutation to A: Results in an 1800-fold decrease in catalytic activity.
- S142 (≠ H111) binding in other chain
- A160 (≠ S129) binding in other chain
- TK 165:166 (= TK 134:135) binding
- R180 (≠ K149) binding
- R183 (≠ K152) binding in other chain
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; Partial
- 17 binding
- 71 binding
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 78% coverage: 24:164/181 of query aligns to 32:166/191 of G3XD01
- K136 (= K135) mutation to A: Reduction in catalytic activity.; mutation to R: No effect on catalytic activity.
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
36% identity, 61% coverage: 45:155/181 of query aligns to 55:167/211 of 4hurA
- binding acetyl coenzyme *a: S67 (≠ E57), I68 (= I58), G69 (≠ A59), A79 (≠ S72), N80 (≠ Y73), K110 (≠ S98), W120 (≠ L108), I121 (= I109), G122 (= G110), R123 (≠ H111), M128 (= M116), A140 (= A128), A141 (≠ S129), T146 (= T134), G156 (= G144), P159 (= P147), I163 (= I151), R164 (≠ K152)
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
36% identity, 61% coverage: 45:155/181 of query aligns to 55:167/212 of 4husA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
36% identity, 61% coverage: 45:155/181 of query aligns to 55:167/206 of 6x3jA
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: V55 (= V45), H91 (≠ N84), L92 (≠ K85), M101 (vs. gap), P102 (vs. gap), L107 (≠ R95)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ A59), A79 (≠ S72), H81 (≠ V74), W120 (≠ L108), G122 (= G110)
Sites not aligning to the query:
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: 51, 53
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
36% identity, 61% coverage: 45:155/181 of query aligns to 55:167/207 of 6x3cA
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (≠ S71), N80 (≠ Y73), H81 (≠ V74), H91 (≠ N84), L92 (≠ K85), M101 (vs. gap), P102 (vs. gap), L104 (≠ F92)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ A59), N80 (≠ Y73), H81 (≠ V74), W120 (≠ L108), G122 (= G110), R123 (≠ H111), M128 (= M116), A140 (= A128), A141 (≠ S129)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 17, 36, 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
36% identity, 61% coverage: 45:155/181 of query aligns to 55:167/203 of 6x3cE
- binding magnesium ion: N158 (≠ V146), P159 (= P147)
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (≠ S71), N80 (≠ Y73), H81 (≠ V74), H91 (≠ N84), L92 (≠ K85), M101 (vs. gap), P102 (vs. gap)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (≠ A59), H81 (≠ V74), M83 (≠ I76), W120 (≠ L108), G122 (= G110), A140 (= A128), A141 (≠ S129)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
Query Sequence
>WP_013817130.1 NCBI__GCF_000214665.1:WP_013817130.1
MKDQIKEFLKACRAKYLLITKYRGTTAGKGFHVGKNVIIRGNNCVFGDYVFIGENSEIAP
AVTIGNYAMISSYVAITGSDHIYNKPGVAIRFSGRPDSVKTHIGHDVLIGHGAIVMRGVT
IGNGAVIASGAVVTKDVPAYAVMGGVPAKFIKWRFDHEQQKLHEAMLYSPTKFINGLERP
F
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory