SitesBLAST
Comparing WP_013818165.1 NCBI__GCF_000214665.1:WP_013818165.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
41% identity, 81% coverage: 1:429/527 of query aligns to 6:429/533 of O43175
- T78 (≠ I74) binding
- R135 (= R131) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ TI 151:152) binding
- D175 (= D171) binding
- T207 (≠ C203) binding
- CAR 234:236 (= CAR 230:232) binding
- D260 (= D256) binding
- V261 (= V257) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (= HLGA 279:282) binding
- A373 (≠ E369) to T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- G377 (= G373) to S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- V425 (= V425) to M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
36% identity, 97% coverage: 4:514/527 of query aligns to 4:512/526 of 3dc2A
- active site: N96 (= N98), R230 (= R232), D254 (= D256), E259 (= E261), H277 (= H279)
- binding serine: Y458 (≠ H460), D460 (= D462), R461 (≠ K463), P462 (= P464), G463 (= G465), A464 (≠ V466), L465 (≠ I467), L484 (≠ V486)
7dkmA Phgdh covalently linked to oridonin (see paper)
47% identity, 58% coverage: 1:304/527 of query aligns to 2:304/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ I74), A102 (≠ T102), G148 (= G148), R151 (≠ T151), I152 (= I152), Y170 (= Y170), D171 (= D171), P172 (= P172), I173 (≠ F173), H202 (= H202), T203 (≠ C203), P204 (= P204), T209 (= T209), C230 (= C230), A231 (= A231), R232 (= R232), H279 (= H279), G281 (= G281)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ G14), K17 (≠ F17), I18 (≠ L18), E293 (≠ V293)
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
47% identity, 58% coverage: 1:304/527 of query aligns to 1:303/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
47% identity, 58% coverage: 1:304/527 of query aligns to 2:304/305 of 6plfA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
48% identity, 57% coverage: 1:300/527 of query aligns to 1:299/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
48% identity, 57% coverage: 1:300/527 of query aligns to 1:299/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (= L147), G147 (= G148), L148 (≠ F149), G149 (= G150), R150 (≠ T151), I151 (= I152), G152 (= G153), D170 (= D171), H201 (= H202), T202 (≠ C203), P203 (= P204)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
48% identity, 57% coverage: 1:300/527 of query aligns to 1:299/302 of 6rihA
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
36% identity, 97% coverage: 4:514/527 of query aligns to 5:511/525 of 3ddnB
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
48% identity, 57% coverage: 2:300/527 of query aligns to 1:298/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N98), A100 (≠ T102), R149 (≠ T151), I150 (= I152), Y168 (= Y170), D169 (= D171), P170 (= P172), I171 (≠ F173), H200 (= H202), T201 (≠ C203), P202 (= P204), T207 (= T209), C228 (= C230), A229 (= A231), R230 (= R232), H277 (= H279), G279 (= G281)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
48% identity, 56% coverage: 2:298/527 of query aligns to 1:296/297 of 6rj3A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
48% identity, 56% coverage: 4:300/527 of query aligns to 1:296/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G150), I148 (= I152), Y166 (= Y170), D167 (= D171), P168 (= P172), I169 (≠ F173), I170 (≠ V174), H198 (= H202), T199 (≠ C203), L208 (≠ V212), R228 (= R232)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
47% identity, 57% coverage: 2:300/527 of query aligns to 1:290/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ T151), Y160 (= Y170), D161 (= D171), P162 (= P172), I164 (≠ V174), L179 (= L189), T193 (≠ C203), P194 (= P204), S198 (≠ K208), L202 (≠ V212)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
45% identity, 57% coverage: 3:304/527 of query aligns to 2:303/304 of 1wwkA
- active site: S96 (≠ N98), R230 (= R232), D254 (= D256), E259 (= E261), H278 (= H279)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ T102), G146 (= G148), F147 (= F149), G148 (= G150), R149 (≠ T151), I150 (= I152), Y168 (= Y170), D169 (= D171), P170 (= P172), V201 (≠ C203), P202 (= P204), T207 (= T209), T228 (≠ C230), S229 (≠ A231), D254 (= D256), H278 (= H279), G280 (= G281)
7cvpA The crystal structure of human phgdh from biortus.
45% identity, 49% coverage: 43:300/527 of query aligns to 21:253/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G148), G103 (= G150), R104 (≠ T151), I105 (= I152), Y123 (= Y170), D124 (= D171), P125 (= P172), I126 (≠ F173), H155 (= H202), T156 (≠ C203), P157 (= P204), T162 (= T209), C183 (= C230), A184 (= A231), R185 (= R232), H232 (= H279), G234 (= G281)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
36% identity, 63% coverage: 3:335/527 of query aligns to 57:398/466 of P87228
- S87 (= S33) modified: Phosphoserine
- S258 (≠ L206) modified: Phosphoserine
6rj6A Crystal structure of phgdh in complex with bi-4924 (see paper)
49% identity, 38% coverage: 101:300/527 of query aligns to 5:204/204 of 6rj6A
- binding 2-[4-[(1~{S})-1-[[4,5-bis(chloranyl)-1,6-dimethyl-indol-2-yl]carbonylamino]-2-oxidanyl-ethyl]phenyl]sulfonylethanoic acid: G52 (= G148), R55 (≠ T151), I56 (= I152), Y74 (= Y170), D75 (= D171), P76 (= P172), I77 (≠ F173), I78 (≠ V174), H106 (= H202), T107 (≠ C203), P108 (= P204), T113 (= T209)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
36% identity, 57% coverage: 3:302/527 of query aligns to 4:311/334 of 5aovA
- active site: L100 (≠ N98), R241 (= R232), D265 (= D256), E270 (= E261), H288 (= H279)
- binding glyoxylic acid: M52 (≠ R50), L53 (≠ S51), L53 (≠ S51), Y74 (≠ A72), A75 (≠ G73), V76 (≠ I74), G77 (= G75), R241 (= R232), H288 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ I74), T104 (= T102), F158 (= F149), G159 (= G150), R160 (≠ T151), I161 (= I152), S180 (≠ D171), R181 (≠ P172), A211 (≠ H202), V212 (≠ C203), P213 (= P204), T218 (= T209), I239 (≠ C230), A240 (= A231), R241 (= R232), H288 (= H279), G290 (= G281)
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
48% identity, 37% coverage: 96:288/527 of query aligns to 1:193/195 of 5ofwA
- active site: N3 (= N98), R137 (= R232), D161 (= D256), E166 (= E261), H184 (= H279)
- binding 3-chloranyl-4-fluoranyl-benzamide: G53 (= G148), Y75 (= Y170), P77 (= P172), T108 (≠ C203), S113 (≠ K208), T114 (= T209), L117 (≠ V212)
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
48% identity, 37% coverage: 96:288/527 of query aligns to 1:193/195 of 5ofvA
Query Sequence
>WP_013818165.1 NCBI__GCF_000214665.1:WP_013818165.1
MKKILISDKLADDGINFLNEQAGIQIHIQTGLSEAELCEIIPEYDALLIRSDTQVTANVL
KAAKKLKVVGRAGIGVDNVDLAVAMEQGIIVMNTPDANATTTAELAIAHMFSLSRNLPIA
NQSVRDGKWERSKLVGAEISHKTLAILGFGTIGRIVAQRGNGLGMRVIAYDPFVAPEIFE
KCGAEMVDLDTLVKHADYLTLHCPLLEKTRNVIGREQFAMMKKTARLINCARGGLVDEAA
LYDALKEGRIAGAALDVYEQEPPRDSPLLSLDNVVFTPHLGASTKEAQVAVSVEIARQVV
KYLQTGEAINALNLPRLSAEELKQAQPFMNLAHILGKVLLGLIDQPIQKLEVAVFGKAAL
GKIRPISAEAMVGLLAGQFDTPVNRVNVENIAKRQGIALVESQTEEAEGYQSLIKITGHC
VDKSVSLAGTLLGDHHPRLVSINHFEIEVVPEGALVVTRHDDKPGVIAAISSILGVSNIN
ITRMQVSVADENQLSMMVISVSDPLSEQVLKAVCDVPAVQSARQIVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory