Comparing WP_013819183.1 NCBI__GCF_000214665.1:WP_013819183.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
46% identity, 98% coverage: 3:385/390 of query aligns to 1:375/375 of 2eh6A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
46% identity, 98% coverage: 3:385/390 of query aligns to 2:376/376 of O66442
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
43% identity, 98% coverage: 4:386/390 of query aligns to 10:391/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
43% identity, 98% coverage: 4:386/390 of query aligns to 2:383/385 of Q9X2A5
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 97% coverage: 5:382/390 of query aligns to 69:450/457 of Q9M8M7
Sites not aligning to the query:
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
44% identity, 98% coverage: 5:385/390 of query aligns to 11:383/390 of A0QYS9
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
43% identity, 95% coverage: 5:374/390 of query aligns to 10:378/390 of 8ht4B
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
45% identity, 98% coverage: 5:385/390 of query aligns to 19:393/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
45% identity, 98% coverage: 5:385/390 of query aligns to 13:387/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
45% identity, 98% coverage: 5:385/390 of query aligns to 13:387/391 of 7nn4A
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
39% identity, 98% coverage: 3:386/390 of query aligns to 2:386/388 of 3nx3A
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
39% identity, 95% coverage: 5:374/390 of query aligns to 12:384/400 of 4addA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
39% identity, 95% coverage: 5:374/390 of query aligns to 12:384/401 of 4adbB
5eqcA Structure of the ornithine aminotransferase from toxoplasma gondii crystallized in presence of oxidized glutathione reveals partial occupancy of plp at the protein active site
39% identity, 95% coverage: 4:373/390 of query aligns to 29:405/426 of 5eqcA
Sites not aligning to the query:
5e3kB Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with (s)-4-amino-5-fluoropentanoic acid
39% identity, 95% coverage: 4:373/390 of query aligns to 28:404/424 of 5e3kB
5e3kA Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with (s)-4-amino-5-fluoropentanoic acid
39% identity, 95% coverage: 4:373/390 of query aligns to 27:403/422 of 5e3kA
5e5iA Structure of the ornithine aminotransferase from toxoplasma gondii in complex with inactivator
39% identity, 95% coverage: 4:373/390 of query aligns to 26:402/421 of 5e5iA
5dj9A Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with gabaculine
39% identity, 95% coverage: 4:373/390 of query aligns to 26:402/421 of 5dj9A
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
37% identity, 95% coverage: 5:374/390 of query aligns to 12:384/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 95% coverage: 5:374/390 of query aligns to 17:389/405 of P40732
>WP_013819183.1 NCBI__GCF_000214665.1:WP_013819183.1
MTTHIMPTYARQTVTFDRGEGAWLWDSNGKRYLDALAGIAVCNLGHAHPAVHQALCKQSQ
TLIHTSNLYGVKLQAELADKLCRLSGMDNVFFCNSGAEANEAAIKIARKYGHEQGIDAPV
ILTMDKSFHGRTMGALSATGNTKIKQGFAPLLPGFVHVPYNNIDAIISAIHADKNIVAIL
VEPVQGEGGVNIPDADYLNRIRALCDEHQLLLMLDEIQTGIGRTGEFLAYQRNQILPDVC
TLAKALGNGVPIGACMARGKAAAILTAGNHGSTFGGNPLACSAALAVLDTLCSTDLIADA
DRKGKRICDAVTRQLEGNPHIVSIRHLGLMIGIELDAPCGELVGKALEQGLLINVTADNT
IRLLPPLLIDDAQIDLLTETLSALIKEHNH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory