SitesBLAST
Comparing WP_013819184.1 NCBI__GCF_000214665.1:WP_013819184.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
45% identity, 98% coverage: 1:293/299 of query aligns to 9:305/316 of Q81M99
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
46% identity, 98% coverage: 4:297/299 of query aligns to 8:310/315 of Q51742
- W22 (≠ R18) mutation to A: Decreased heat stability.
- E26 (≠ Y22) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ Q26) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ H30) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (≠ V215) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ Q228) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E265) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
45% identity, 98% coverage: 1:293/299 of query aligns to 5:301/307 of 4nf2A
- active site: R55 (= R53), T56 (= T54), R83 (= R81), R104 (= R102), H131 (= H129), Q134 (= Q132), D226 (= D217), C265 (= C257), R293 (= R285)
- binding phosphoric acid mono(formamide)ester: S53 (= S51), T54 (= T52), R55 (= R53), T56 (= T54), R104 (= R102), H131 (= H129), Q134 (= Q132), C265 (= C257), L266 (= L258), R293 (= R285)
- binding norvaline: L126 (= L124), N162 (= N160), D226 (= D217), S230 (= S221), M231 (= M222)
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
42% identity, 98% coverage: 4:297/299 of query aligns to 2:302/304 of 8qeuA
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
41% identity, 98% coverage: 4:297/299 of query aligns to 2:295/297 of 8qevA
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
44% identity, 99% coverage: 4:299/299 of query aligns to 4:307/308 of 7nouA
- active site: R102 (= R102), H129 (= H129), Q132 (= Q132), D225 (= D217), C265 (= C257), R293 (= R285)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (≠ V46), T52 (= T52), R53 (= R53), R53 (= R53), F56 (≠ I56), F56 (≠ I56), L79 (= L79), D82 (≠ G82), E83 (= E83), V91 (= V91), Y95 (≠ M95), L266 (= L258), R293 (= R285)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
44% identity, 99% coverage: 4:299/299 of query aligns to 4:307/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
44% identity, 99% coverage: 4:299/299 of query aligns to 4:307/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
44% identity, 99% coverage: 4:299/299 of query aligns to 4:307/308 of 7nnyA
- active site: R102 (= R102), H129 (= H129), Q132 (= Q132), D225 (= D217), C265 (= C257), R293 (= R285)
- binding 1-naphthol: T52 (= T52), R53 (= R53), F56 (≠ I56), E83 (= E83), V91 (= V91), Y95 (≠ M95)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
44% identity, 99% coverage: 4:299/299 of query aligns to 4:307/308 of 7nnwA
- active site: R102 (= R102), H129 (= H129), Q132 (= Q132), D225 (= D217), C265 (= C257), R293 (= R285)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (≠ V46), T52 (= T52), R53 (= R53), F56 (≠ I56), L79 (= L79), L92 (≠ I92), Y95 (≠ M95)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
44% identity, 99% coverage: 4:299/299 of query aligns to 4:307/308 of 7nnvA
- active site: R102 (= R102), H129 (= H129), Q132 (= Q132), D225 (= D217), C265 (= C257), R293 (= R285)
- binding phosphoric acid mono(formamide)ester: S51 (= S51), T52 (= T52), R53 (= R53), T54 (= T54), R102 (= R102), H129 (= H129), C265 (= C257), L266 (= L258), R293 (= R285)
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
44% identity, 99% coverage: 4:299/299 of query aligns to 3:306/307 of 2i6uA
- active site: R52 (= R53), T53 (= T54), R80 (= R81), R101 (= R102), H128 (= H129), Q131 (= Q132), D224 (= D217), C264 (= C257), R292 (= R285)
- binding phosphoric acid mono(formamide)ester: S50 (= S51), T51 (= T52), R52 (= R53), T53 (= T54), R101 (= R102), C264 (= C257), L265 (= L258), R292 (= R285)
- binding norvaline: L123 (= L124), N160 (= N160), D224 (= D217), S228 (= S221), M229 (= M222)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 99% coverage: 4:299/299 of query aligns to 3:306/307 of P9WIT9
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
41% identity, 95% coverage: 1:285/299 of query aligns to 37:330/354 of P00481
- R92 (= R53) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (= C257) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
41% identity, 95% coverage: 1:285/299 of query aligns to 37:330/354 of P00480
- G39 (≠ P3) to C: in OTCD; late onset; dbSNP:rs72554306
- R40 (= R4) to H: in OTCD; late onset; dbSNP:rs72554308
- L43 (≠ I7) to F: in dbSNP:rs72554309
- K46 (≠ L10) to R: in dbSNP:rs1800321
- Y55 (≠ N19) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (= L27) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (= K49) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 51:54) binding
- G100 (= G61) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ M62) to L: in dbSNP:rs1133135
- L111 (= L72) to P: in dbSNP:rs1800324
- T125 (≠ E86) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D87) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (≠ K90) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (≠ L101) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R102) binding ; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H129) binding
- Q171 (= Q132) binding
- I172 (≠ L133) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ M137) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TY 139:140) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ R144) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (= G149) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (= G156) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (= D157) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ C162) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (≠ A168) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (≠ R170) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (≠ F174) to K: in OTCD; late onset
- H214 (≠ K175) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P181) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (= P186) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ V198) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (= T216) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (≠ V218) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W219) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G223) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (= Q224) to R: in dbSNP:rs1800328
- E272 (≠ S226) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (= R231) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H256) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (= C257) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (= CL 257:258) binding
- E309 (= E264) natural variant: Missing (in OTCD; late onset)
- R330 (= R285) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
- 333 natural variant: T -> A
- 340 S → P: in OTCD; late onset; dbSNP:rs72558489
- 343 T → K: in OTCD; late onset; dbSNP:rs72558491
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
40% identity, 95% coverage: 1:285/299 of query aligns to 4:297/321 of 1othA
- active site: R59 (= R53), T60 (= T54), V87 (≠ R81), R108 (= R102), H135 (= H129), Q138 (= Q132), D230 (= D217), C270 (= C257), R297 (= R285)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S51), T58 (= T52), R59 (= R53), T60 (= T54), R108 (= R102), L130 (= L124), H135 (= H129), N166 (= N160), D230 (= D217), S234 (= S221), M235 (= M222), C270 (= C257), L271 (= L258), R297 (= R285)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
40% identity, 95% coverage: 1:285/299 of query aligns to 4:297/321 of 1c9yA
- active site: R59 (= R53), T60 (= T54), V87 (≠ R81), R108 (= R102), H135 (= H129), Q138 (= Q132), D230 (= D217), C270 (= C257), R297 (= R285)
- binding phosphoric acid mono(formamide)ester: S57 (= S51), T58 (= T52), R59 (= R53), T60 (= T54), R108 (= R102), C270 (= C257), L271 (= L258), R297 (= R285)
- binding norvaline: L130 (= L124), N166 (= N160), D230 (= D217), S234 (= S221), M235 (= M222)
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
44% identity, 99% coverage: 4:299/299 of query aligns to 4:304/305 of 7np0A
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
43% identity, 99% coverage: 4:299/299 of query aligns to 4:301/302 of 7novA
- active site: R96 (= R102), H123 (= H129), Q126 (= Q132), D219 (= D217), C259 (= C257), R287 (= R285)
- binding (4-methyl-3-nitro-phenyl)-oxidanyl-oxidanylidene-boron: R53 (= R53), F56 (≠ I56), E77 (= E83), V85 (= V91), Y89 (≠ M95), L260 (= L258), A284 (= A282), R287 (= R285)
P05150 Ornithine carbamoyltransferase; Ornithine transcarbamylase; OTCase; EC 2.1.3.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
39% identity, 98% coverage: 4:297/299 of query aligns to 12:328/338 of P05150
- T68 (= T52) mutation to G: Reduces activity by 95%. Reduces affinity for ornithine 2-fold.
- G181 (= G156) mutation to R: Loss of activity.
- D182 (= D157) mutation to N: Reduces activity by 33%. Reduces affinity for ornithine 30-fold.
- N184 (= N159) mutation to Q: Reduces activity by 50%. Reduces affinity for ornithine 20-fold.
- N185 (= N160) mutation to Q: No effect on activity. Reduces affinity for ornithine 200-fold.
- E256 (≠ Q224) mutation to Q: Reduces activity by 50%.
- K263 (≠ R231) mutation to A: Reduces activity by 70%. Reduces affinity for ornithine 18-fold.
- C289 (= C257) mutation to S: Reduces activity by 90%. Reduces affinity for ornithine 6-fold.
- L290 (= L258) mutation to S: Reduces activity by 86%.
Query Sequence
>WP_013819184.1 NCBI__GCF_000214665.1:WP_013819184.1
MQPRHFISLLDLSGAELRNLIYRAIQLKTHRDPDFQPLKGKVLAMVFEKSSTRTRISFEA
GMTQFGGSAIFLSPRDTQLGRGEPLEDSAKVISSMVDCIMLRTNEHDTVTTFAKYSRVPV
INGLTDLLHPCQLLADMQTYFEHRGDIAGKTVAWIGDGNNMCHSYINAARQFDFKLHIAS
PADYGPVQDIVDAAADKVAFFNSPVLAAQQADLVVTDVWASMGQESEQKKREYAFRDFQV
TEEVMQAANPDALFMHCLPAHRGEEVAAEVIDGSQSVVFDEAENRLHAQKALLEFLICR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory