Comparing WP_013834834.1 NCBI__GCF_000214825.1:WP_013834834.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9HTN2 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
71% identity, 98% coverage: 7:304/304 of query aligns to 1:298/301 of Q9HTN2
2bufC Arginine feed-back inhibitable acetylglutamate kinase (see paper)
71% identity, 97% coverage: 9:304/304 of query aligns to 2:297/298 of 2bufC
2bufA Arginine feed-back inhibitable acetylglutamate kinase (see paper)
70% identity, 97% coverage: 9:304/304 of query aligns to 2:289/292 of 2bufA
2bufK Arginine feed-back inhibitable acetylglutamate kinase (see paper)
66% identity, 97% coverage: 9:302/304 of query aligns to 2:272/273 of 2bufK
2btyA Acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine (see paper)
51% identity, 93% coverage: 19:301/304 of query aligns to 7:277/282 of 2btyA
Q9X2A4 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
51% identity, 93% coverage: 19:301/304 of query aligns to 7:277/282 of Q9X2A4
2v5hB Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 (see paper)
51% identity, 95% coverage: 14:301/304 of query aligns to 3:281/289 of 2v5hB
Q9SCL7 Acetylglutamate kinase, chloroplastic; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; AtNAGK; EC 2.7.2.8 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
47% identity, 93% coverage: 20:302/304 of query aligns to 72:346/347 of Q9SCL7
Sites not aligning to the query:
2rd5B Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana (see paper)
47% identity, 93% coverage: 20:302/304 of query aligns to 8:282/283 of 2rd5B
4usjB N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii (see paper)
47% identity, 93% coverage: 20:302/304 of query aligns to 6:280/281 of 4usjB
7nlwA Crystal structure of mycobacterium tuberculosis argb in complex with 2-(5-methoxy-1h-indol-3-yl)acetonitrile
46% identity, 93% coverage: 18:299/304 of query aligns to 10:286/290 of 7nlwA
7nlyA Crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole.
46% identity, 93% coverage: 18:299/304 of query aligns to 12:288/293 of 7nlyA
7nnbA Crystal structure of mycobacterium tuberculosis argb in complex with 2,8-bis(trifluoromethyl)quinolin-4-ol.
46% identity, 93% coverage: 18:299/304 of query aligns to 10:286/291 of 7nnbA
7nn8A Crystal structure of mycobacterium tuberculosis argb in complex with 1h-indole-3-carbonitrile.
46% identity, 93% coverage: 18:299/304 of query aligns to 10:286/291 of 7nn8A
7nm0A Crystal structure of mycobacterium tuberculosis argb in complex with 1-(2,6-dihydroxyphenyl)ethan-1-one.
46% identity, 93% coverage: 18:299/304 of query aligns to 10:286/291 of 7nm0A
7nlzA Crystal structure of mycobacterium tuberculosis argb in complex with 5-methoxy-6-(trifluoromethyl)indole.
46% identity, 93% coverage: 18:299/304 of query aligns to 10:286/291 of 7nlzA
7nltA Crystal structure of mycobacterium tuberculosis argb in complex with 4-(4-methylpiperazin-1-yl)benzoic acid
46% identity, 93% coverage: 18:299/304 of query aligns to 10:286/291 of 7nltA
7nlrA Crystal structure of mycobacterium tuberculosis argb in complex with 2-phenyl-1h-imidazole
46% identity, 93% coverage: 18:299/304 of query aligns to 10:286/291 of 7nlrA
7nlpA Crystal structure of mycobacterium tuberculosis argb in complex with l-canavanine
46% identity, 93% coverage: 18:299/304 of query aligns to 11:287/292 of 7nlpA
Sites not aligning to the query:
7nloA Crystal structure of mycobacterium tuberculosis argb in complex with l-arginine
46% identity, 93% coverage: 18:299/304 of query aligns to 8:284/289 of 7nloA
Sites not aligning to the query:
>WP_013834834.1 NCBI__GCF_000214825.1:WP_013834834.1
MRVQKTMNLNKDQAQNIASVLAEALPYIQRFAGKTIVVKYGGNAMTEDHLMASFARDIVL
MKLVGMNPVVVHGGGPQIGDLLKRVGKESEFVQGMRVTDTETMDIVEMVLGGLVNKEIVN
LIHQHGGNSVGLTGKDGNLIMAKKLKVTKHTPDMDEPEIIDIGHVGEVSRINTGVIDMLI
QGDFIPVIAPVGVDEEGHSYNINADLVAGKVAEALQAEKLMLLTNTPGLLNQQGELLTGL
NAKMVDELIADGTIYGGMLPKIQCALDAVQGGVKAAHIVDGRVDHAVMLEVFTDEGVGTL
ITAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory