Comparing WP_013835162.1 NCBI__GCF_000214825.1:WP_013835162.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rl5G The first crystal structure of the daba aminotransferase ectb in the ectoine biosynthesis pathway of the model organism chromohalobacter salexigens dsm 3034 (see paper)
46% identity, 95% coverage: 4:411/428 of query aligns to 3:415/422 of 6rl5G
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 93% coverage: 14:410/428 of query aligns to 17:420/426 of P22256
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
32% identity, 93% coverage: 14:410/428 of query aligns to 16:419/425 of 1sffA
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
32% identity, 93% coverage: 14:410/428 of query aligns to 16:419/425 of 1sf2A
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
32% identity, 93% coverage: 14:410/428 of query aligns to 16:419/425 of 1szkA
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
31% identity, 92% coverage: 20:411/428 of query aligns to 11:376/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
31% identity, 92% coverage: 20:411/428 of query aligns to 10:375/375 of 2eh6A
P50457 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 from Escherichia coli (strain K12) (see paper)
32% identity, 90% coverage: 26:411/428 of query aligns to 28:419/421 of P50457
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
30% identity, 91% coverage: 21:411/428 of query aligns to 18:389/390 of 8ht4B
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
29% identity, 92% coverage: 20:411/428 of query aligns to 18:390/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
29% identity, 92% coverage: 20:411/428 of query aligns to 10:382/385 of Q9X2A5
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
31% identity, 87% coverage: 34:405/428 of query aligns to 33:389/401 of 4adbB
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
31% identity, 87% coverage: 34:405/428 of query aligns to 33:389/400 of 4addA
Sites not aligning to the query:
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
30% identity, 76% coverage: 31:356/428 of query aligns to 69:388/453 of 4uoxA
Sites not aligning to the query:
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
28% identity, 86% coverage: 31:396/428 of query aligns to 73:432/456 of 4uoxC
Sites not aligning to the query:
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
28% identity, 86% coverage: 31:396/428 of query aligns to 75:434/459 of P42588
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 89% coverage: 34:416/428 of query aligns to 38:405/405 of P40732
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
28% identity, 94% coverage: 10:411/428 of query aligns to 1:385/388 of 3nx3A
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
30% identity, 90% coverage: 34:417/428 of query aligns to 33:401/402 of 4jevB
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
32% identity, 90% coverage: 30:416/428 of query aligns to 29:387/387 of 1wkhA
Sites not aligning to the query:
>WP_013835162.1 NCBI__GCF_000214825.1:WP_013835162.1
MDISLFEQYESNVRGYIRSFPAVFDTATSATIVDVEGKRYIDFFGGAGSLNYGHNHPLIN
QALITYIQRNGITNALDKATVAKHDFISAFQSIILKPRKMDYKIQFVGPTGANGVETALK
LARKMKKRSNVIAFTNAYHGHSLGALAVTGNEFYHGDYYDVPRNVNKMPYDNYFDHDMDS
VDMLRHYLGDGSSGYELPAAVIVESIQGEGGINVASVGWLQKLSALCKEMDILLIMDEIQ
VGNGRTGDYFSFERAGIMPDIITLSKSIGTGMPMSIVLMKPSVDVWSPGEHTGTFRGNSY
AFIAGAAALELWRNDDFSRSIRAKGKQVEAAFKDFQARFPGWITDVRGLGMIWGLESLVE
GFCNEVSKQAFQRGLMMETAGASDQVLKFLGPLVISETELNEGFEILTDAILAAVAVFEK
TGRTPCAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory