Comparing WP_013841580.1 NCBI__GCF_000215085.1:WP_013841580.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
36% identity, 99% coverage: 7:797/799 of query aligns to 9:832/841 of 8g3hA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
37% identity, 69% coverage: 11:560/799 of query aligns to 15:554/560 of 3bofA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
37% identity, 69% coverage: 11:560/799 of query aligns to 15:554/559 of 1q8jA
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
30% identity, 99% coverage: 7:798/799 of query aligns to 26:891/1265 of Q99707
Sites not aligning to the query:
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 99% coverage: 6:799/799 of query aligns to 11:872/1227 of P13009
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
29% identity, 67% coverage: 7:544/799 of query aligns to 10:573/611 of 4cczA
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
38% identity, 32% coverage: 314:571/799 of query aligns to 7:265/271 of 2ycjA
2yciX Methyltransferase native (see paper)
38% identity, 32% coverage: 314:571/799 of query aligns to 7:265/271 of 2yciX
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
38% identity, 32% coverage: 314:571/799 of query aligns to 8:266/272 of 2yckX
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
40% identity, 32% coverage: 320:571/799 of query aligns to 4:256/262 of 4djfA
4djeA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate (see paper)
40% identity, 32% coverage: 320:571/799 of query aligns to 4:256/262 of 4djeA
4djdA Crystal structure of folate-free corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr) (see paper)
40% identity, 32% coverage: 320:571/799 of query aligns to 4:256/262 of 4djdA
2e7fA 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 angsrom resolution (see paper)
40% identity, 32% coverage: 320:571/799 of query aligns to 4:256/262 of 2e7fA
Q46389 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein co-methyltransferase; 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase; MeTr; EC 2.1.1.258 from Moorella thermoacetica (Clostridium thermoaceticum) (see 2 papers)
40% identity, 32% coverage: 320:571/799 of query aligns to 4:256/262 of Q46389
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
43% identity, 22% coverage: 616:791/799 of query aligns to 28:207/215 of 7xcnP
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
37% identity, 25% coverage: 596:797/799 of query aligns to 4:206/507 of 8sseA
Sites not aligning to the query:
4o1eA Structure of a methyltransferase component in complex with mthf involved in o-demethylation (see paper)
34% identity, 32% coverage: 314:570/799 of query aligns to 2:258/271 of 4o1eA
4o1fA Structure of a methyltransferase component in complex with thf involved in o-demethylation (see paper)
35% identity, 32% coverage: 316:570/799 of query aligns to 1:254/267 of 4o1fA
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
31% identity, 29% coverage: 568:799/799 of query aligns to 10:243/258 of 2i2xB
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
31% identity, 29% coverage: 568:799/799 of query aligns to 10:243/258 of Q46EH4
Sites not aligning to the query:
>WP_013841580.1 NCBI__GCF_000215085.1:WP_013841580.1
MSFKDRVQREILIVDGAMGTLLQERGLPAGWCPEEWNVSHPEVIKEVHGLYLRAGADIIT
TNTFGAIPLKLEEYDMPDRVREFNLAAGRLAREAAKPFGAMVAGSVGPLGKFLQPLGTLS
FDEAYQQFLVQCRALVEAEVDLILFETFGDIGEMRAALIAAADAGSVPVVASFTFDESGR
TFTGTDPETAAVVAERLGVAAVGVNCSVGPRQLEGVVRQLTRSTNLPVLISPNAGMPEIV
EGRTVFRETPEVLADYAARFVDYGASLLGGCCGTTPEHIKAISQAVKDLEIKTRNKSFGL
RVASRVKTVAIHPAGMPVAIGERLNPTGKKALQAEIKEGKTEITRRDALAQVEAGAEILD
VNVGVGGVDPIAAMERAIHAVQVLVDAPLCIDSTDPAVIEHALKLYHGKAIINSVNGEDQ
SMETILPLAKRYGAALIGLTLDERGIPPTAEERLAVAGKIVARAEEMGIPREDIMIDCLV
LTVSAQPEGVPETLKAISLVKQELGLATSLGVSNVSFGLPNRKLINSAFFAMALSAGLDA
AILNPQEERMMETLRASAVLTGRDLRAEKYIVREQVRAEAPVKQKEDEKKASTPREILYR
AVLSGDKDNIIRYIEEALGQGMGPLEMLDKALIPAIEEVGRRYAQGVYFLPQLIMAGETM
TKSFECLRPALAKGLTKKVATVVLATVKGDIHDIGKNIVSVMLANHGFEVIDLGKNVDNQ
RIIEAVREHRAGLIGLSALMTTTMIHMPELIKDVKEAGLACKVMVGGAAVTAQYAKEIGA
DGYAEDAVEAVRIAKELIS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory