Comparing WP_013842893.1 NCBI__GCF_000215085.1:WP_013842893.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
42% identity, 92% coverage: 4:279/300 of query aligns to 9:282/295 of 6cyzA
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
33% identity, 87% coverage: 5:266/300 of query aligns to 2:273/310 of P00547
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
32% identity, 91% coverage: 4:276/300 of query aligns to 2:275/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
32% identity, 91% coverage: 4:276/300 of query aligns to 2:275/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
32% identity, 91% coverage: 4:276/300 of query aligns to 2:275/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
32% identity, 91% coverage: 4:276/300 of query aligns to 2:275/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
32% identity, 91% coverage: 4:276/300 of query aligns to 2:275/296 of 1fwkA
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 87% coverage: 4:264/300 of query aligns to 53:326/370 of Q8L7R2
Sites not aligning to the query:
4dxlA Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp (see paper)
28% identity, 92% coverage: 26:300/300 of query aligns to 41:304/304 of 4dxlA
Sites not aligning to the query:
3pyeA Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with cdpme
25% identity, 92% coverage: 26:300/300 of query aligns to 37:300/301 of 3pyeA
Sites not aligning to the query:
3pyfA Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp
25% identity, 92% coverage: 26:300/300 of query aligns to 33:296/296 of 3pyfA
Sites not aligning to the query:
3pygA Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with adp
25% identity, 92% coverage: 26:300/300 of query aligns to 34:297/298 of 3pygA
Sites not aligning to the query:
6mdeA Mevalonate kinase from methanosarcina mazei with mevalonate bound (see paper)
23% identity, 75% coverage: 76:299/300 of query aligns to 75:301/302 of 6mdeA
Sites not aligning to the query:
6mdfA Mevalonate kinase from methanosarcina mazei with 5-phosphomevalonate bound (see paper)
23% identity, 75% coverage: 76:299/300 of query aligns to 76:302/303 of 6mdfA
Sites not aligning to the query:
4hacA Crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei (see paper)
23% identity, 75% coverage: 76:299/300 of query aligns to 85:311/312 of 4hacA
Sites not aligning to the query:
>WP_013842893.1 NCBI__GCF_000215085.1:WP_013842893.1
MNNSVKVTVPATTANMGPGFDCLGMALKLYNQVEISPTDGGLAIEIQGEGAGDIRKDEGN
IVFKAVERLFQEAGRPCPGLVIKLTNHIPAARGLGSSASAIVGGLVAANRLAGDPFTPEK
LLALATELEGHPDNVAPALLGGIIISVVQEGKVHWLKITPPDGLSTVVAVPDFKLSTRAA
REVLPKTVSLQDAVFNLSRSALLVGALCGKRLDLLQVAGEDLLHQPYRSQLVPGMTEVIS
NARRAGALNVTLSGAGPAVIALTDGPNPQVAQVMENSFAAAGVKCLVKVLEPTVAGAEII
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory