Comparing WP_014026579.1 NCBI__GCF_000223395.1:WP_014026579.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
49% identity, 58% coverage: 176:427/437 of query aligns to 215:467/489 of O94582
Sites not aligning to the query:
7pi1DDD Aminodeoxychorismate synthase component 1
36% identity, 87% coverage: 58:437/437 of query aligns to 59:456/459 of 7pi1DDD
Sites not aligning to the query:
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
36% identity, 87% coverage: 58:437/437 of query aligns to 61:463/470 of P28820
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
50% identity, 59% coverage: 174:430/437 of query aligns to 249:511/524 of A0QX93
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
48% identity, 59% coverage: 174:430/437 of query aligns to 228:490/505 of 5cwaA
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
49% identity, 59% coverage: 174:430/437 of query aligns to 228:486/499 of 7bvdA
Sites not aligning to the query:
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
46% identity, 60% coverage: 174:437/437 of query aligns to 234:504/511 of 1i7sA
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
46% identity, 60% coverage: 174:437/437 of query aligns to 240:510/517 of 1i7qA
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
46% identity, 60% coverage: 174:437/437 of query aligns to 239:509/512 of 1i1qA
Sites not aligning to the query:
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
46% identity, 60% coverage: 174:437/437 of query aligns to 243:513/520 of P00898
Sites not aligning to the query:
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
39% identity, 66% coverage: 149:437/437 of query aligns to 268:570/577 of Q94GF1
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
46% identity, 60% coverage: 174:437/437 of query aligns to 242:512/519 of P00897
Sites not aligning to the query:
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 60% coverage: 174:437/437 of query aligns to 307:588/595 of P32068
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
36% identity, 60% coverage: 173:434/437 of query aligns to 190:451/453 of P05041
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
37% identity, 68% coverage: 140:434/437 of query aligns to 377:670/673 of 8hx8A
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
39% identity, 60% coverage: 173:434/437 of query aligns to 366:631/632 of 8hx9A
Sites not aligning to the query:
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
35% identity, 60% coverage: 173:434/437 of query aligns to 188:435/437 of 1k0eA
Sites not aligning to the query:
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
32% identity, 60% coverage: 173:434/437 of query aligns to 190:418/420 of 1k0gA
Sites not aligning to the query:
5jy9B An iron-bound structure of the salicylate synthase irp9 (see paper)
31% identity, 70% coverage: 123:430/437 of query aligns to 113:418/424 of 5jy9B
2fn1A Crystal structures of yersinia enterocolitica salicylate synthase (irp9) in complex with the reaction products salicylate and pyruvate (see paper)
34% identity, 58% coverage: 177:430/437 of query aligns to 147:402/408 of 2fn1A
>WP_014026579.1 NCBI__GCF_000223395.1:WP_014026579.1
MGLQLGVGEPLEEWSGCGKRPLARIPEPRRLVAWAEKRYDYVALLESGEGFPERARYTLV
AMGANRVYETDDILDGFNVLWKALRGRGCDALPCRSMLFGVVSYEAVAGVEPWLAPKLRR
HTWPVVRVFEPEVLVVYDRLTGRAYVCPGDADLGEAEIGGFVQARGPVYETPREEFEAWV
REAKRLIEEGEFFQIVLSRVERYEYNGSPLALYERLAGGNPSPYMFYLRMGDHWIVGTSP
ELLVKMSLGRAETHPIAGTRPRGKTPEEDVALEEEMLRDEKERAEHMMLVDLARNDLGRI
AVPGTVRVTALMDVEKYSHVQHLVSRVEALVKPKTLYSDVLAATFPAGTVSGAPKTRAME
YIAVLEDEPRGPYAGAVGVYAERAGETAIVIRSVWSYEDGIVEARAGAGIVYDSVPEREY
METVHKIMAVRRALGVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory