Comparing WP_014026810.1 NCBI__GCF_000223395.1:WP_014026810.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
6n2oC 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
34% identity, 89% coverage: 42:393/397 of query aligns to 219:567/572 of 6n2oC
Sites not aligning to the query:
6n2oA 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
34% identity, 89% coverage: 42:393/397 of query aligns to 219:567/572 of 6n2oA
Sites not aligning to the query:
6n2nA Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
34% identity, 89% coverage: 42:393/397 of query aligns to 219:567/572 of 6n2nA
P72578 2-oxoacid:ferredoxin oxidoreductase subunit alpha; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see 2 papers)
31% identity, 94% coverage: 23:394/397 of query aligns to 230:611/632 of P72578
Q96Y66 2-oxoacid:ferredoxin oxidoreductase 1, subunit alpha; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
31% identity, 94% coverage: 23:394/397 of query aligns to 230:611/627 of Q96Y66
Sites not aligning to the query:
5b48A 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
30% identity, 94% coverage: 23:394/397 of query aligns to 198:563/576 of 5b48A
Q96XT2 2-oxoacid:ferredoxin oxidoreductase 2, subunit alpha; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
30% identity, 91% coverage: 32:391/397 of query aligns to 240:609/628 of Q96XT2
5b47A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
31% identity, 85% coverage: 32:368/397 of query aligns to 239:586/627 of 5b47A
5b46A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
31% identity, 85% coverage: 32:368/397 of query aligns to 239:586/627 of 5b46A
5exeA Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
24% identity, 84% coverage: 26:357/397 of query aligns to 7:325/394 of 5exeA
5exdD Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
24% identity, 84% coverage: 26:357/397 of query aligns to 7:325/394 of 5exdD
5c4iA Structure of an oxalate oxidoreductase (see paper)
24% identity, 84% coverage: 26:357/397 of query aligns to 7:325/394 of 5c4iA
>WP_014026810.1 NCBI__GCF_000223395.1:WP_014026810.1
MQLKPLVKLQEEPPKLPVKPGYYFESGAWAIAIGAILAGARFFAFYPIEPATDIAEALVE
LFPRAGGVVIQTEDEISALAAAIGASWAGVKAFTATSGPGMSLMTEHISYAVMTETPVVI
IDGMRAGPSTGQATKASQQDVMQAKWGAHGDYEIIAYSPSSAQELLEYTIKAFNAAERWR
VPAFILADKMTVLLMENVKVPDPSEVVRVDRKRPRVPPGDPNFKPFEPEEDLVPPMPRFG
EGYGIHVTGVTHNELGVAVSDDPIVHHQLVKRLCDKIRKNRDKIVEYEVFGDENPTHVIV
AYGFVARAARRAVRMLREKGVKAALFRPITLWPFPGPELARFARNAEKILVAEMNYGQVV
HLVAEHVGGWERVELEPRIGELPPTPEELAERLVSKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory