SitesBLAST
Comparing WP_014027226.1 NCBI__GCF_000223395.1:WP_014027226.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 30:581/607 of 6u9dB
- active site: Y33 (≠ V20), G35 (= G22), G36 (= G23), A37 (≠ S24), I38 (= I25), E59 (= E46), T82 (= T69), F121 (= F108), Q122 (= Q109), E123 (= E110), K171 (≠ R158), M274 (= M254), V301 (≠ T281), V417 (= V387), G443 (= G413), M445 (= M415), D470 (= D440), N497 (= N467), E499 (≠ A469), Q500 (≠ L470), M502 (≠ L472), V503 (= V473), W506 (= W476)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (= G23), V111 (= V98), P112 (= P99), F121 (= F108), K171 (≠ R158), D299 (= D279), R300 (= R280), M502 (≠ L472), W506 (= W476)
- binding flavin-adenine dinucleotide: R161 (= R148), A228 (≠ G209), G229 (= G210), N232 (≠ W213), T254 (= T234), L255 (= L235), Q256 (≠ T236), L272 (≠ A252), M274 (= M254), G294 (= G274), R296 (= R276), D298 (≠ S278), R300 (= R280), V301 (≠ T281), E327 (≠ D298), V328 (≠ I299), N332 (≠ E303), D346 (= D317), A347 (= A318), M422 (= M392), G440 (≠ A410), G441 (= G411)
- binding magnesium ion: D470 (= D440), N497 (= N467)
- binding thiamine diphosphate: E59 (= E46), P85 (= P72), V417 (= V387), G418 (= G388), Q419 (≠ S389), H420 (= H390), G443 (= G413), M445 (= M415), A471 (≠ G441), S472 (= S442), N497 (= N467), E499 (≠ A469), Q500 (≠ L470), G501 (≠ M471), M502 (≠ L472), V503 (= V473)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 110:661/687 of P07342
- R241 (= R148) binding
- 355:376 (vs. 255:276, 59% identical) binding
- 407:426 (vs. 298:317, 25% identical) binding
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 26:569/595 of 1t9bB
- active site: Y29 (≠ V20), G31 (= G22), G32 (= G23), A33 (≠ S24), I34 (= I25), E55 (= E46), T78 (= T69), F117 (= F108), Q118 (= Q109), E119 (= E110), K167 (≠ R158), R226 (≠ E219), M262 (= M254), V289 (≠ T281), V405 (= V387), L430 (= L412), G431 (= G413), M433 (= M415), D458 (= D440), N485 (= N467), E487 (≠ A469), Q488 (≠ L470), M490 (≠ L472), V491 (= V473), W494 (= W476), L516 (≠ V499), G521 (≠ D504), L522 (≠ I505), K555 (≠ R538)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V98), P108 (= P99), D287 (= D279), R288 (= R280), M490 (≠ L472), W494 (= W476)
- binding flavin-adenine dinucleotide: R157 (= R148), G215 (= G208), A216 (≠ G209), G217 (= G210), N220 (≠ W213), T242 (= T234), L243 (= L235), Q244 (≠ T236), M259 (≠ P251), L260 (≠ A252), M262 (= M254), H263 (= H255), G282 (= G274), A283 (≠ T275), R284 (= R276), D286 (≠ S278), R288 (= R280), V289 (≠ T281), E315 (≠ D298), V316 (≠ I299), N320 (≠ E303), G333 (≠ A316), D334 (= D317), A335 (= A318), Q409 (= Q391), M410 (= M392), G428 (≠ A410), G429 (= G411)
- binding magnesium ion: D458 (= D440), N485 (= N467), E487 (≠ A469)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 27:571/597 of 1t9aA
- active site: Y30 (≠ V20), G32 (= G22), G33 (= G23), A34 (≠ S24), I35 (= I25), E56 (= E46), T79 (= T69), F118 (= F108), Q119 (= Q109), E120 (= E110), K168 (≠ R158), R228 (≠ E219), M264 (= M254), V291 (≠ T281), V407 (= V387), L432 (= L412), G433 (= G413), M435 (= M415), D460 (= D440), N487 (= N467), E489 (≠ A469), Q490 (≠ L470), M492 (≠ L472), V493 (= V473), W496 (= W476), L518 (≠ V499), G523 (≠ D504), L524 (≠ I505), K557 (≠ R538)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G23), V108 (= V98), P109 (= P99), F118 (= F108), K168 (≠ R158), M264 (= M254), D289 (= D279), R290 (= R280), M492 (≠ L472), V493 (= V473), W496 (= W476)
- binding flavin-adenine dinucleotide: R158 (= R148), G217 (= G208), A218 (≠ G209), G219 (= G210), N222 (≠ W213), T244 (= T234), L245 (= L235), Q246 (≠ T236), L262 (≠ A252), M264 (= M254), H265 (= H255), G284 (= G274), A285 (≠ T275), R286 (= R276), D288 (≠ S278), R290 (= R280), V291 (≠ T281), E317 (≠ D298), V318 (≠ I299), N322 (≠ E303), G335 (≠ A316), D336 (= D317), A337 (= A318), Q411 (= Q391), M412 (= M392), G430 (≠ A410), G431 (= G411)
- binding magnesium ion: D460 (= D440), N487 (= N467), E489 (≠ A469)
- binding propyl trihydrogen diphosphate: V407 (= V387), G408 (= G388), Q409 (≠ S389), H410 (= H390), M435 (= M415), G459 (= G439), D460 (= D440), A461 (≠ G441), S462 (= S442), N487 (= N467), E489 (≠ A469), Q490 (≠ L470), G491 (≠ M471), M492 (≠ L472)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G413), M435 (= M415), M465 (= M445)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 26:570/596 of 1t9dA
- active site: Y29 (≠ V20), G31 (= G22), G32 (= G23), A33 (≠ S24), I34 (= I25), E55 (= E46), T78 (= T69), F117 (= F108), Q118 (= Q109), E119 (= E110), K167 (≠ R158), R227 (≠ E219), M263 (= M254), V290 (≠ T281), V406 (= V387), L431 (= L412), G432 (= G413), M434 (= M415), D459 (= D440), N486 (= N467), E488 (≠ A469), Q489 (≠ L470), M491 (≠ L472), V492 (= V473), W495 (= W476), L517 (≠ V499), G522 (≠ D504), L523 (≠ I505), K556 (≠ R538)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G23), A33 (≠ S24), V107 (= V98), P108 (= P99), F117 (= F108), K167 (≠ R158), M263 (= M254), D288 (= D279), R289 (= R280), W495 (= W476)
- binding flavin-adenine dinucleotide: R157 (= R148), G216 (= G208), A217 (≠ G209), G218 (= G210), N221 (≠ W213), T243 (= T234), L244 (= L235), Q245 (≠ T236), M260 (≠ P251), L261 (≠ A252), H264 (= H255), G283 (= G274), A284 (≠ T275), R285 (= R276), D287 (≠ S278), R289 (= R280), V290 (≠ T281), E316 (≠ D298), V317 (≠ I299), N321 (≠ E303), G334 (≠ A316), D335 (= D317), A336 (= A318), Q410 (= Q391), M411 (= M392), G429 (≠ A410), G430 (= G411)
- binding magnesium ion: D459 (= D440), N486 (= N467), E488 (≠ A469)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E46), P81 (= P72), Q118 (= Q109), G432 (= G413), M434 (= M415), M464 (= M445)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 26:570/596 of 1t9cA
- active site: Y29 (≠ V20), G31 (= G22), G32 (= G23), A33 (≠ S24), I34 (= I25), E55 (= E46), T78 (= T69), F117 (= F108), Q118 (= Q109), E119 (= E110), K167 (≠ R158), R227 (≠ E219), M263 (= M254), V290 (≠ T281), V406 (= V387), L431 (= L412), G432 (= G413), M434 (= M415), D459 (= D440), N486 (= N467), E488 (≠ A469), Q489 (≠ L470), M491 (≠ L472), V492 (= V473), W495 (= W476), L517 (≠ V499), G522 (≠ D504), L523 (≠ I505), K556 (≠ R538)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G23), V107 (= V98), P108 (= P99), F117 (= F108), K167 (≠ R158), D288 (= D279), R289 (= R280), W495 (= W476)
- binding flavin-adenine dinucleotide: R157 (= R148), G216 (= G208), A217 (≠ G209), G218 (= G210), N221 (≠ W213), T243 (= T234), L244 (= L235), Q245 (≠ T236), L261 (≠ A252), M263 (= M254), H264 (= H255), G283 (= G274), A284 (≠ T275), R285 (= R276), D287 (≠ S278), R289 (= R280), V290 (≠ T281), E316 (≠ D298), V317 (≠ I299), N321 (≠ E303), G334 (≠ A316), D335 (= D317), A336 (= A318), M411 (= M392), G429 (≠ A410), G430 (= G411)
- binding magnesium ion: D459 (= D440), N486 (= N467), E488 (≠ A469)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 28:573/599 of 1n0hA
- active site: Y31 (≠ V20), G33 (= G22), G34 (= G23), A35 (≠ S24), I36 (= I25), E57 (= E46), T80 (= T69), F119 (= F108), Q120 (= Q109), E121 (= E110), K169 (≠ R158), R230 (≠ E219), M266 (= M254), V293 (≠ T281), V409 (= V387), L434 (= L412), G435 (= G413), M437 (= M415), D462 (= D440), N489 (= N467), E491 (≠ A469), Q492 (≠ L470), M494 (≠ L472), V495 (= V473), W498 (= W476), L520 (≠ V499), G525 (≠ D504), L526 (≠ I505), K559 (≠ R538)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V387), G410 (= G388), Q411 (≠ S389), H412 (= H390), G435 (= G413), M437 (= M415), G461 (= G439), D462 (= D440), A463 (≠ G441), S464 (= S442), M467 (= M445), N489 (= N467), E491 (≠ A469), Q492 (≠ L470), G493 (≠ M471), V495 (= V473)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G23), A35 (≠ S24), V109 (= V98), P110 (= P99), F119 (= F108), K169 (≠ R158), M266 (= M254), D291 (= D279), R292 (= R280), V495 (= V473), W498 (= W476)
- binding flavin-adenine dinucleotide: R159 (= R148), G219 (= G208), A220 (≠ G209), G221 (= G210), N224 (≠ W213), T246 (= T234), L247 (= L235), Q248 (≠ T236), L264 (≠ A252), G265 (= G253), M266 (= M254), H267 (= H255), G286 (= G274), A287 (≠ T275), R288 (= R276), D290 (≠ S278), R292 (= R280), V293 (≠ T281), E319 (≠ D298), V320 (≠ I299), N324 (≠ E303), G337 (≠ A316), D338 (= D317), A339 (= A318), M414 (= M392), G432 (≠ A410), G433 (= G411)
- binding magnesium ion: D462 (= D440), N489 (= N467), E491 (≠ A469)
- binding thiamine diphosphate: Y31 (≠ V20), E57 (= E46), P83 (= P72)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 26:565/591 of 5wkcA
- active site: Y29 (≠ V20), G31 (= G22), G32 (= G23), A33 (≠ S24), I34 (= I25), E55 (= E46), T78 (= T69), F117 (= F108), Q118 (= Q109), E119 (= E110), K167 (≠ R158), R222 (≠ E219), M258 (= M254), V285 (≠ T281), V401 (= V387), L426 (= L412), G427 (= G413), M429 (= M415), D454 (= D440), N481 (= N467), E483 (≠ A469), Q484 (≠ L470), M486 (≠ L472), V487 (= V473), W490 (= W476), L512 (≠ V499), G517 (≠ D504), L518 (≠ I505), K551 (≠ R538)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V387), G402 (= G388), Q403 (≠ S389), H404 (= H390), G427 (= G413), M429 (= M415), G453 (= G439), D454 (= D440), A455 (≠ G441), S456 (= S442), M459 (= M445), N481 (= N467), E483 (≠ A469), Q484 (≠ L470), G485 (≠ M471), M486 (≠ L472), V487 (= V473)
- binding ethaneperoxoic acid: G32 (= G23), Q118 (= Q109)
- binding flavin-adenine dinucleotide: R157 (= R148), G211 (= G208), A212 (≠ G209), G213 (= G210), N216 (≠ W213), T238 (= T234), L239 (= L235), Q240 (≠ T236), L256 (≠ A252), M258 (= M254), G278 (= G274), A279 (≠ T275), R280 (= R276), R284 (= R280), V285 (≠ T281), E311 (≠ D298), V312 (≠ I299), N316 (≠ E303), D330 (= D317), A331 (= A318), M406 (= M392), G424 (≠ A410)
- binding magnesium ion: D454 (= D440), N481 (= N467), E483 (≠ A469)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G23), A33 (≠ S24), V107 (= V98), F117 (= F108), K167 (≠ R158), M258 (= M254), R284 (= R280), M486 (≠ L472), W490 (= W476)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (≠ T21), E55 (= E46)
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 25:556/582 of 1t9dB
- active site: Y28 (≠ V20), G30 (= G22), G31 (= G23), A32 (≠ S24), I33 (= I25), E54 (= E46), T77 (= T69), F116 (= F108), Q117 (= Q109), E118 (= E110), K166 (≠ R158), R213 (≠ E219), M249 (= M254), V276 (≠ T281), V392 (= V387), L417 (= L412), G418 (= G413), M420 (= M415), D445 (= D440), N472 (= N467), E474 (≠ A469), Q475 (≠ L470), M477 (≠ L472), V478 (= V473), W481 (= W476), L503 (≠ V499), G508 (≠ D504), L509 (≠ I505), K542 (≠ R538)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (= G23), A32 (≠ S24), V106 (= V98), P107 (= P99), F116 (= F108), K166 (≠ R158), M249 (= M254), D274 (= D279), R275 (= R280), W481 (= W476)
- binding flavin-adenine dinucleotide: R156 (= R148), G202 (= G208), A203 (≠ G209), G204 (= G210), N207 (≠ W213), T229 (= T234), L230 (= L235), Q231 (≠ T236), L247 (≠ A252), M249 (= M254), H250 (= H255), G269 (= G274), A270 (≠ T275), R271 (= R276), D273 (≠ S278), R275 (= R280), V276 (≠ T281), E302 (≠ D298), V303 (≠ I299), N307 (≠ E303), G320 (≠ A316), D321 (= D317), A322 (= A318), Q396 (= Q391), M397 (= M392), G415 (≠ A410), G416 (= G411)
- binding magnesium ion: D445 (= D440), N472 (= N467), E474 (≠ A469)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E46), P80 (= P72), G418 (= G413), M420 (= M415), M450 (= M445)
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
37% identity, 94% coverage: 17:553/571 of query aligns to 26:557/583 of 1t9bA
- active site: Y29 (≠ V20), G31 (= G22), G32 (= G23), A33 (≠ S24), I34 (= I25), E55 (= E46), T78 (= T69), F117 (= F108), Q118 (= Q109), E119 (= E110), K167 (≠ R158), R214 (≠ E219), M250 (= M254), V277 (≠ T281), V393 (= V387), L418 (= L412), G419 (= G413), M421 (= M415), D446 (= D440), N473 (= N467), E475 (≠ A469), Q476 (≠ L470), M478 (≠ L472), V479 (= V473), W482 (= W476), L504 (≠ V499), G509 (≠ D504), L510 (≠ I505), K543 (≠ R538)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V98), P108 (= P99), F117 (= F108), D275 (= D279), R276 (= R280), M478 (≠ L472), W482 (= W476)
- binding flavin-adenine dinucleotide: R157 (= R148), G203 (= G208), A204 (≠ G209), G205 (= G210), N208 (≠ W213), T230 (= T234), L231 (= L235), Q232 (≠ T236), M247 (≠ P251), L248 (≠ A252), M250 (= M254), H251 (= H255), G270 (= G274), A271 (≠ T275), R272 (= R276), D274 (≠ S278), R276 (= R280), V277 (≠ T281), E303 (≠ D298), V304 (≠ I299), N308 (≠ E303), D322 (= D317), A323 (= A318), Q397 (= Q391), M398 (= M392), G416 (≠ A410), G417 (= G411)
- binding magnesium ion: D446 (= D440), N473 (= N467), E475 (≠ A469)
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
36% identity, 95% coverage: 17:558/571 of query aligns to 30:577/598 of 6desA
- active site: Y33 (≠ V20), G35 (= G22), G36 (= G23), A37 (≠ S24), I38 (= I25), E59 (= E46), T82 (= T69), F121 (= F108), Q122 (= Q109), E123 (= E110), K171 (≠ R158), K229 (≠ E219), M265 (= M254), V292 (≠ T281), V408 (= V387), L433 (= L412), G434 (= G413), M436 (= M415), D461 (= D440), N488 (= N467), E490 (≠ A469), Q491 (≠ L470), M493 (≠ L472), V494 (= V473), W497 (= W476), L519 (≠ V499), N524 (≠ D504), V525 (≠ I505)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (= M254), D290 (= D279), R291 (= R280), W497 (= W476)
- binding flavin-adenine dinucleotide: R161 (= R148), G218 (= G208), A219 (≠ G209), G220 (= G210), N223 (≠ W213), T245 (= T234), L246 (= L235), Q247 (≠ T236), L263 (≠ A252), G285 (= G274), A286 (≠ T275), R287 (= R276), D289 (≠ S278), R291 (= R280), V292 (≠ T281), E318 (≠ D298), I319 (= I299), N323 (≠ E303), D337 (= D317), V338 (≠ A318), Q412 (= Q391), M413 (= M392), G431 (≠ A410)
- binding magnesium ion: D461 (= D440), N488 (= N467), E490 (≠ A469)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V387), G409 (= G388), Q410 (≠ S389), H411 (= H390), G434 (= G413), M436 (= M415), G460 (= G439), D461 (= D440), A462 (≠ G441), S463 (= S442), N488 (= N467), E490 (≠ A469), Q491 (≠ L470), G492 (≠ M471), M493 (≠ L472), V494 (= V473)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
36% identity, 95% coverage: 17:558/571 of query aligns to 30:577/598 of 6depA
- active site: Y33 (≠ V20), G35 (= G22), G36 (= G23), A37 (≠ S24), I38 (= I25), E59 (= E46), T82 (= T69), F121 (= F108), Q122 (= Q109), E123 (= E110), K171 (≠ R158), K229 (≠ E219), M265 (= M254), V292 (≠ T281), V408 (= V387), L433 (= L412), G434 (= G413), M436 (= M415), D461 (= D440), N488 (= N467), E490 (≠ A469), Q491 (≠ L470), M493 (≠ L472), V494 (= V473), W497 (= W476), L519 (≠ V499), N524 (≠ D504), V525 (≠ I505)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (= D279), R291 (= R280), M493 (≠ L472), W497 (= W476)
- binding flavin-adenine dinucleotide: R161 (= R148), G218 (= G208), A219 (≠ G209), G220 (= G210), N223 (≠ W213), T245 (= T234), L246 (= L235), Q247 (≠ T236), L263 (≠ A252), G264 (= G253), G285 (= G274), A286 (≠ T275), R287 (= R276), D289 (≠ S278), R291 (= R280), V292 (≠ T281), E318 (≠ D298), I319 (= I299), N323 (≠ E303), D337 (= D317), V338 (≠ A318), M413 (= M392), G431 (≠ A410)
- binding magnesium ion: D461 (= D440), N488 (= N467), E490 (≠ A469)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (= V387), G409 (= G388), Q410 (≠ S389), H411 (= H390), G434 (= G413), M436 (= M415), G460 (= G439), D461 (= D440), A462 (≠ G441), S463 (= S442), M466 (= M445), N488 (= N467), E490 (≠ A469), Q491 (≠ L470), G492 (≠ M471), M493 (≠ L472), V494 (= V473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V387), G409 (= G388), Q410 (≠ S389), H411 (= H390), G434 (= G413), M436 (= M415), G460 (= G439), D461 (= D440), A462 (≠ G441), S463 (= S442), M466 (= M445), N488 (= N467), E490 (≠ A469), Q491 (≠ L470), G492 (≠ M471), M493 (≠ L472), V494 (= V473)
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
36% identity, 95% coverage: 17:558/571 of query aligns to 32:579/600 of 6derA
- active site: Y35 (≠ V20), G37 (= G22), G38 (= G23), A39 (≠ S24), I40 (= I25), E61 (= E46), T84 (= T69), F123 (= F108), Q124 (= Q109), E125 (= E110), K173 (≠ R158), K231 (≠ E219), M267 (= M254), V294 (≠ T281), V410 (= V387), L435 (= L412), G436 (= G413), M438 (= M415), D463 (= D440), N490 (= N467), E492 (≠ A469), Q493 (≠ L470), M495 (≠ L472), V496 (= V473), W499 (= W476), L521 (≠ V499), N526 (≠ D504), V527 (≠ I505)
- binding flavin-adenine dinucleotide: R163 (= R148), G220 (= G208), A221 (≠ G209), G222 (= G210), N225 (≠ W213), T247 (= T234), L248 (= L235), Q249 (≠ T236), L265 (≠ A252), H268 (= H255), G287 (= G274), A288 (≠ T275), R289 (= R276), D291 (≠ S278), R293 (= R280), V294 (≠ T281), E320 (≠ D298), I321 (= I299), N325 (≠ E303), G338 (≠ A316), D339 (= D317), V340 (≠ A318), Q414 (= Q391), M415 (= M392), G433 (≠ A410)
- binding Metosulam: R293 (= R280), M495 (≠ L472), W499 (= W476), A570 (≠ P549)
- binding magnesium ion: D463 (= D440), N490 (= N467), E492 (≠ A469)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (= V387), G411 (= G388), Q412 (≠ S389), H413 (= H390), G436 (= G413), M438 (= M415), G462 (= G439), D463 (= D440), A464 (≠ G441), S465 (= S442), N490 (= N467), E492 (≠ A469), Q493 (≠ L470), G494 (≠ M471), M495 (≠ L472), V496 (= V473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (= V387), G411 (= G388), Q412 (≠ S389), H413 (= H390), G436 (= G413), M438 (= M415), G462 (= G439), D463 (= D440), A464 (≠ G441), S465 (= S442), M468 (= M445), N490 (= N467), E492 (≠ A469), Q493 (≠ L470), G494 (≠ M471), V496 (= V473)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
36% identity, 95% coverage: 17:558/571 of query aligns to 30:576/597 of 6demA
- active site: Y33 (≠ V20), G35 (= G22), G36 (= G23), A37 (≠ S24), I38 (= I25), E59 (= E46), T82 (= T69), F121 (= F108), Q122 (= Q109), E123 (= E110), K171 (≠ R158), K228 (≠ E219), M264 (= M254), V291 (≠ T281), V407 (= V387), L432 (= L412), G433 (= G413), M435 (= M415), D460 (= D440), N487 (= N467), E489 (≠ A469), Q490 (≠ L470), M492 (≠ L472), V493 (= V473), W496 (= W476), L518 (≠ V499), N523 (≠ D504), V524 (≠ I505)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (= M254), D289 (= D279), R290 (= R280), M492 (≠ L472), W496 (= W476), A567 (≠ P549)
- binding flavin-adenine dinucleotide: R161 (= R148), G217 (= G208), A218 (≠ G209), G219 (= G210), N222 (≠ W213), T244 (= T234), L245 (= L235), Q246 (≠ T236), L262 (≠ A252), G284 (= G274), A285 (≠ T275), R286 (= R276), D288 (≠ S278), R290 (= R280), V291 (≠ T281), E317 (≠ D298), I318 (= I299), N322 (≠ E303), D336 (= D317), V337 (≠ A318), M412 (= M392), G430 (≠ A410)
- binding magnesium ion: D460 (= D440), N487 (= N467), E489 (≠ A469)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V387), G408 (= G388), Q409 (≠ S389), H410 (= H390), M435 (= M415), G459 (= G439), D460 (= D440), A461 (≠ G441), S462 (= S442), M465 (= M445), N487 (= N467), E489 (≠ A469), Q490 (≠ L470), G491 (≠ M471), M492 (≠ L472), V493 (= V473)
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
36% identity, 95% coverage: 17:558/571 of query aligns to 30:576/597 of 6delA
- active site: Y33 (≠ V20), G35 (= G22), G36 (= G23), A37 (≠ S24), I38 (= I25), E59 (= E46), T82 (= T69), F121 (= F108), Q122 (= Q109), E123 (= E110), K171 (≠ R158), K228 (≠ E219), M264 (= M254), V291 (≠ T281), V407 (= V387), L432 (= L412), G433 (= G413), M435 (= M415), D460 (= D440), N487 (= N467), E489 (≠ A469), Q490 (≠ L470), M492 (≠ L472), V493 (= V473), W496 (= W476), L518 (≠ V499), N523 (≠ D504), V524 (≠ I505)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (= D279), R290 (= R280), W496 (= W476)
- binding flavin-adenine dinucleotide: R161 (= R148), G217 (= G208), A218 (≠ G209), G219 (= G210), N222 (≠ W213), T244 (= T234), L245 (= L235), Q246 (≠ T236), L262 (≠ A252), G284 (= G274), A285 (≠ T275), R286 (= R276), D288 (≠ S278), R290 (= R280), V291 (≠ T281), E317 (≠ D298), I318 (= I299), N322 (≠ E303), D336 (= D317), V337 (≠ A318), M412 (= M392), G430 (≠ A410)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (= V387), G408 (= G388), Q409 (≠ S389), H410 (= H390), G433 (= G413), M435 (= M415), G459 (= G439), D460 (= D440), A461 (≠ G441), S462 (= S442), M465 (= M445), N487 (= N467), E489 (≠ A469), Q490 (≠ L470), G491 (≠ M471), M492 (≠ L472), V493 (= V473)
- binding magnesium ion: D460 (= D440), N487 (= N467), E489 (≠ A469)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V387), G408 (= G388), Q409 (≠ S389), H410 (= H390), G433 (= G413), M435 (= M415), G459 (= G439), D460 (= D440), A461 (≠ G441), S462 (= S442), M465 (= M445), N487 (= N467), E489 (≠ A469), Q490 (≠ L470), G491 (≠ M471), M492 (≠ L472), V493 (= V473)
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
36% identity, 95% coverage: 17:558/571 of query aligns to 32:578/599 of 6denA
- active site: Y35 (≠ V20), G37 (= G22), G38 (= G23), A39 (≠ S24), I40 (= I25), E61 (= E46), T84 (= T69), F123 (= F108), Q124 (= Q109), E125 (= E110), K173 (≠ R158), K230 (≠ E219), M266 (= M254), V293 (≠ T281), V409 (= V387), L434 (= L412), G435 (= G413), M437 (= M415), D462 (= D440), N489 (= N467), E491 (≠ A469), Q492 (≠ L470), M494 (≠ L472), V495 (= V473), W498 (= W476), L520 (≠ V499), N525 (≠ D504), V526 (≠ I505)
- binding flavin-adenine dinucleotide: R163 (= R148), G219 (= G208), A220 (≠ G209), G221 (= G210), N224 (≠ W213), T246 (= T234), L247 (= L235), Q248 (≠ T236), L264 (≠ A252), G286 (= G274), A287 (≠ T275), R288 (= R276), D290 (≠ S278), R292 (= R280), V293 (≠ T281), E319 (≠ D298), I320 (= I299), N324 (≠ E303), D338 (= D317), V339 (≠ A318), M414 (= M392), G432 (≠ A410)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (= M254), D291 (= D279), R292 (= R280), W498 (= W476)
- binding magnesium ion: D462 (= D440), N489 (= N467), E491 (≠ A469)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (= V387), G410 (= G388), Q411 (≠ S389), H412 (= H390), G435 (= G413), M437 (= M415), G461 (= G439), D462 (= D440), A463 (≠ G441), S464 (= S442), N489 (= N467), E491 (≠ A469), Q492 (≠ L470), G493 (≠ M471), M494 (≠ L472), V495 (= V473)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
36% identity, 95% coverage: 17:558/571 of query aligns to 32:580/601 of 6deqA
- active site: Y35 (≠ V20), G37 (= G22), G38 (= G23), A39 (≠ S24), I40 (= I25), E61 (= E46), T84 (= T69), F123 (= F108), Q124 (= Q109), E125 (= E110), K173 (≠ R158), K232 (≠ E219), M268 (= M254), V295 (≠ T281), V411 (= V387), L436 (= L412), G437 (= G413), M439 (= M415), D464 (= D440), N491 (= N467), E493 (≠ A469), Q494 (≠ L470), M496 (≠ L472), V497 (= V473), W500 (= W476), L522 (≠ V499), N527 (≠ D504), V528 (≠ I505)
- binding flavin-adenine dinucleotide: R163 (= R148), G221 (= G208), A222 (≠ G209), G223 (= G210), N226 (≠ W213), T248 (= T234), L249 (= L235), Q250 (≠ T236), L266 (≠ A252), G288 (= G274), A289 (≠ T275), R290 (= R276), D292 (≠ S278), R294 (= R280), V295 (≠ T281), E321 (≠ D298), I322 (= I299), D340 (= D317), V341 (≠ A318), M416 (= M392), G434 (≠ A410)
- binding magnesium ion: D464 (= D440), N491 (= N467), E493 (≠ A469)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (= M254), R294 (= R280), M496 (≠ L472), V497 (= V473), W500 (= W476), A571 (≠ P549)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V387), G412 (= G388), Q413 (≠ S389), H414 (= H390), M439 (= M415), G463 (= G439), D464 (= D440), A465 (≠ G441), S466 (= S442), N491 (= N467), E493 (≠ A469), Q494 (≠ L470), G495 (≠ M471), M496 (≠ L472), V497 (= V473)
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
36% identity, 95% coverage: 17:558/571 of query aligns to 28:572/593 of 6deoA
- active site: Y31 (≠ V20), G33 (= G22), G34 (= G23), A35 (≠ S24), I36 (= I25), E57 (= E46), T80 (= T69), F119 (= F108), Q120 (= Q109), E121 (= E110), K169 (≠ R158), K224 (≠ E219), M260 (= M254), V287 (≠ T281), V403 (= V387), L428 (= L412), G429 (= G413), M431 (= M415), D456 (= D440), N483 (= N467), E485 (≠ A469), Q486 (≠ L470), M488 (≠ L472), V489 (= V473), W492 (= W476), L514 (≠ V499), N519 (≠ D504), V520 (≠ I505)
- binding flavin-adenine dinucleotide: R159 (= R148), G213 (= G208), A214 (≠ G209), G215 (= G210), N218 (≠ W213), T240 (= T234), L241 (= L235), Q242 (≠ T236), L258 (≠ A252), G280 (= G274), A281 (≠ T275), R282 (= R276), D284 (≠ S278), R286 (= R280), V287 (≠ T281), E313 (≠ D298), I314 (= I299), N318 (≠ E303), D332 (= D317), V333 (≠ A318), M408 (= M392), G426 (≠ A410)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (= M254), D285 (= D279), R286 (= R280), M488 (≠ L472), W492 (= W476)
- binding magnesium ion: D456 (= D440), N483 (= N467), E485 (≠ A469)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (= V387), G404 (= G388), Q405 (≠ S389), H406 (= H390), G429 (= G413), M431 (= M415), G455 (= G439), D456 (= D440), A457 (≠ G441), S458 (= S442), M461 (= M445), N483 (= N467), E485 (≠ A469), Q486 (≠ L470), G487 (≠ M471), M488 (≠ L472), V489 (= V473)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
37% identity, 95% coverage: 9:550/571 of query aligns to 16:532/539 of 6lpiB
- active site: I27 (≠ V20), G29 (= G22), G30 (= G23), S31 (= S24), I32 (= I25), E53 (= E46), C76 (≠ T69), F115 (= F108), Q116 (= Q109), E117 (= E110), K165 (≠ R158), M256 (= M254), A283 (≠ T281), V375 (= V387), G401 (= G413), M403 (= M415), D428 (= D440), N455 (= N467), A457 (= A469), L458 (= L470), L460 (= L472), V461 (= V473), Q464 (≠ W476)
- binding flavin-adenine dinucleotide: R155 (= R148), G212 (= G208), G213 (= G209), G214 (= G210), T236 (= T234), L237 (= L235), M238 (≠ T236), L254 (≠ A252), M256 (= M254), H257 (= H255), G276 (= G274), A277 (≠ T275), R278 (= R276), D280 (≠ S278), R282 (= R280), A283 (≠ T281), D300 (= D298), I301 (= I299), D319 (= D317), V320 (≠ A318), M380 (= M392), G398 (≠ A410)
- binding magnesium ion: D428 (= D440), N455 (= N467)
- binding thiamine diphosphate: E53 (= E46), C76 (≠ T69), P79 (= P72), G376 (= G388), Q377 (≠ S389), H378 (= H390), G401 (= G413), M403 (= M415), G427 (= G439), D428 (= D440), G429 (= G441), S430 (= S442), M433 (= M445), N455 (= N467), A457 (= A469), L458 (= L470), G459 (≠ M471), L460 (= L472), V461 (= V473)
6dekA Crystal structure of candida albicans acetohydroxyacid synthase catalytic subunit (see paper)
35% identity, 95% coverage: 17:558/571 of query aligns to 31:574/595 of 6dekA
- active site: Y34 (≠ V20), G36 (= G22), G37 (= G23), A38 (≠ S24), I39 (= I25), E60 (= E46), T83 (= T69), Q118 (= Q109), E119 (= E110), K167 (≠ R158), K226 (≠ E219), M262 (= M254), V289 (≠ T281), V405 (= V387), L430 (= L412), G431 (= G413), M433 (= M415), D458 (= D440), N485 (= N467), E487 (≠ A469), Q488 (≠ L470), M490 (≠ L472), V491 (= V473), W494 (= W476), L516 (≠ V499), N521 (≠ D504), V522 (≠ I505)
- binding flavin-adenine dinucleotide: R157 (= R148), G215 (= G208), A216 (≠ G209), G217 (= G210), N220 (≠ W213), T242 (= T234), L243 (= L235), Q244 (≠ T236), L260 (≠ A252), M262 (= M254), G282 (= G274), A283 (≠ T275), R284 (= R276), D286 (≠ S278), R288 (= R280), V289 (≠ T281), E315 (≠ D298), I316 (= I299), N320 (≠ E303), D334 (= D317), V335 (≠ A318), M410 (= M392), G428 (≠ A410)
- binding magnesium ion: D458 (= D440), N485 (= N467), E487 (≠ A469)
- binding thiamine diphosphate: V405 (= V387), G406 (= G388), Q407 (≠ S389), H408 (= H390), M433 (= M415), G457 (= G439), D458 (= D440), A459 (≠ G441), S460 (= S442), N485 (= N467), E487 (≠ A469), Q488 (≠ L470), G489 (≠ M471), M490 (≠ L472), V491 (= V473)
Query Sequence
>WP_014027226.1 NCBI__GCF_000223395.1:WP_014027226.1
MVDQVAKTLREMGATDVFGVTGGSIMAFYDAMEVVGGFNIYMFRHEQGAAHAADAYGRVK
KRPAIVAVTSGPGATNIVTGVANAYMDSSPALFITGQVPTTVFGRDAFQETDMVGVVAPI
TKFVYQIRRPEEAVPAIKTAYKLAIMGRPGPTLVDFPRDVQLRRCDCTSDGLLPLNYEKF
KAPDPDPRLIEEAARLLLSARRPVILVGGGVYWSGAWPEVIEIAERLWAPIVTTLTGKNS
VPADHPLVMGPAGMHGRAEADAALANADVILAVGTRFSDRTVGRFEPELKEKKIIHIDID
PSEIGKNVKPAVGIVADAKKALRMLIEKLPEVARRDTKFVDWLLYIRRRYEDAMEKLAER
MKPFAPWKVLKLLRRIVPRDTITATGVGSHQMWSEIHWDVYIPGTWLTSAGLGTMGFCVP
AAIGAKIAAPERTVLCIDGDGSFQMTMNNLALVRDYNLPAIFVIFDNRALMLVKQWQIFL
YERRIVATHFTERPDFVKVAEAYDIEGVRPADYQELEKWVRWAVRNNEPLVVDIMIDREM
DIVYPWVKPGEWLTNALLPPGMEDVSLVYEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory