Comparing WP_014150352.1 NCBI__GCF_000968535.2:WP_014150352.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AB71 Fructose-bisphosphate aldolase class 2; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; Fructose-bisphosphate aldolase class II; Sedoheptulose bisphosphate aldolase; EC 4.1.2.13 from Escherichia coli (strain K12) (see 11 papers)
78% identity, 99% coverage: 4:359/359 of query aligns to 3:359/359 of P0AB71
Sites not aligning to the query:
1dosA Structure of fructose-bisphosphate aldolase (see paper)
77% identity, 99% coverage: 4:359/359 of query aligns to 2:358/358 of 1dosA
1b57A Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate (see paper)
75% identity, 99% coverage: 4:359/359 of query aligns to 2:346/346 of 1b57A
5vjeA Class ii fructose-1,6-bisphosphate aldolase of escherichia coli with d-glucitol 1,6-bisphosphate (see paper)
74% identity, 99% coverage: 4:359/359 of query aligns to 2:339/339 of 5vjeA
5gk5C Apo structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 1.9 angstrom resolution
72% identity, 99% coverage: 4:359/359 of query aligns to 2:335/335 of 5gk5C
1gynA Class ii fructose 1,6-bisphosphate aldolase with cadmium (not zinc) in the active site (see paper)
72% identity, 99% coverage: 4:359/359 of query aligns to 2:333/333 of 1gynA
3qm3A 1.85 angstrom resolution crystal structure of fructose-bisphosphate aldolase (fba) from campylobacter jejuni
63% identity, 99% coverage: 2:357/359 of query aligns to 1:348/350 of 3qm3A
7rgnA Crystal structure of putative fructose-1,6-bisphosphate aldolase from candida auris
52% identity, 97% coverage: 10:359/359 of query aligns to 7:340/340 of 7rgnA
P36580 Fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
53% identity, 99% coverage: 5:359/359 of query aligns to 3:358/358 of P36580
7v6gB Structure of candida albicans fructose-1,6-bisphosphate aldolase mutation c157s with cn39
49% identity, 98% coverage: 8:359/359 of query aligns to 5:338/338 of 7v6gB
7yvaB Crystal structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with lipoic acid
49% identity, 98% coverage: 8:359/359 of query aligns to 5:336/336 of 7yvaB
7v6fA Structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with g3p
49% identity, 98% coverage: 8:359/359 of query aligns to 5:335/335 of 7v6fA
4delA Active site loop dynamics of a class iia fructose 1,6-bisphosphate aldolase from m. Tuberculosis (see paper)
42% identity, 96% coverage: 13:356/359 of query aligns to 2:337/345 of 4delA
Sites not aligning to the query:
3ekzA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
40% identity, 96% coverage: 13:356/359 of query aligns to 2:326/334 of 3ekzA
Sites not aligning to the query:
4a22A Structure of mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase bound to n-(4-hydroxybutyl)- glycolohydroxamic acid bis- phosphate (see paper)
40% identity, 96% coverage: 13:356/359 of query aligns to 2:324/329 of 4a22A
3elfA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
40% identity, 96% coverage: 13:356/359 of query aligns to 2:324/332 of 3elfA
Sites not aligning to the query:
4lv4A A noncompetitive inhibitor for m. Tuberculosis's class iia fructose 1, 6-bisphosphate aldolase (see paper)
36% identity, 96% coverage: 13:356/359 of query aligns to 2:312/320 of 4lv4A
Sites not aligning to the query:
P13243 Probable fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Bacillus subtilis (strain 168) (see paper)
26% identity, 86% coverage: 26:334/359 of query aligns to 13:260/285 of P13243
8q5aA Crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) (see paper)
26% identity, 77% coverage: 28:302/359 of query aligns to 15:237/276 of 8q5aA
3q94A The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'Ames ancestor'
26% identity, 87% coverage: 28:339/359 of query aligns to 15:265/285 of 3q94A
>WP_014150352.1 NCBI__GCF_000968535.2:WP_014150352.1
MAQKILDIVKPGVVTGEDVQKVFAFCKEHKFALPAVNVISTDTINSVLESAAKAKSPVII
QFSNGGAAFFAGKGVNLEGQMPSILGAISGAQHVHLMAEHYGVPVILHTDHAAKKLLPWI
DGLLDAGEKHFEKTGKPLFSSHMLDLSEESLEENIEICGKYLERMSKMDMTLEIELGVTG
GEEDGVDNTDMDHSLLYTQPEDVAYAYENLSKISHRFTIAASFGNVHGVYKPGNVKLTPT
ILRDSQKYVSEKFSLPENSLTFVFHGGSGSSPEEIKESISYGVVKMNIDTDTQWATWAGV
MEFYKKNEGYLQGQIGNPDGDDKPNKKYYDPRVWQRAGQVGMVTRLQQAFQDLNASNTL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory