SitesBLAST
Comparing WP_014449654.1 NCBI__GCF_000284315.1:WP_014449654.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
43% identity, 97% coverage: 10:360/363 of query aligns to 88:439/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
43% identity, 97% coverage: 10:360/363 of query aligns to 8:359/365 of 3zokA
- active site: R122 (= R123), K144 (= K145), E186 (= E187), K228 (= K231), E238 (= E241), R242 (= R245), N246 (= N249), H249 (= H252), H253 (= H256), H266 (= H269)
- binding glycine: K144 (= K145), K228 (= K231), R242 (= R245)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ V47), V45 (= V48), D73 (= D74), E75 (= E76), K78 (= K79), G106 (= G107), G107 (= G108), V108 (= V109), D111 (= D112), T131 (≠ S132), T132 (= T133), M134 (≠ V135), D138 (= D139), S139 (= S140), K144 (= K145), K153 (= K154), T174 (= T175), L175 (= L176), E179 (= E180), H266 (= H269)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
40% identity, 96% coverage: 13:360/363 of query aligns to 13:355/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
40% identity, 96% coverage: 13:360/363 of query aligns to 14:354/360 of 3okfA
- active site: R120 (= R123), K142 (= K145), E184 (= E187), K226 (= K231), R238 (= R245), N242 (= N249), H245 (= H252), H249 (= H256), H262 (= H269)
- binding nicotinamide-adenine-dinucleotide: N42 (= N45), L48 (= L51), D71 (= D74), E73 (= E76), K76 (= K79), G104 (= G107), G105 (= G108), V106 (= V109), D109 (= D112), T129 (≠ S132), T130 (= T133), L132 (≠ V135), D136 (= D139), T172 (= T175), L173 (= L176), E177 (= E180)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
40% identity, 89% coverage: 39:360/363 of query aligns to 36:349/355 of 5eksA
- active site: R120 (= R123), K142 (= K145), E184 (= E187), K226 (= K231), R237 (= R245), N241 (= N249), H244 (= H252), H248 (= H256), H261 (= H269)
- binding magnesium ion: E184 (= E187), H244 (= H252), H261 (= H269)
- binding nicotinamide-adenine-dinucleotide: N42 (= N45), V45 (= V48), D71 (= D74), E73 (= E76), K76 (= K79), G104 (= G107), G105 (= G108), V106 (= V109), D109 (= D112), T129 (≠ S132), T130 (= T133), D136 (= D139), S137 (= S140), K142 (= K145), T172 (= T175), L173 (= L176), E177 (= E180)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
41% identity, 89% coverage: 39:361/363 of query aligns to 37:359/363 of 6llaB
- active site: R121 (= R123), K143 (= K145), E185 (= E187), K227 (= K231), E237 (= E241), R242 (= R245), N246 (= N249), H249 (= H252), H253 (= H256), H266 (= H269)
- binding magnesium ion: E185 (= E187), H249 (= H252), H266 (= H269)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V48), D72 (= D74), E74 (= E76), K77 (= K79), G105 (= G107), G106 (= G108), V107 (= V109), D110 (= D112), T130 (≠ S132), T131 (= T133), L133 (≠ V135), D137 (= D139), K143 (= K145), T173 (= T175), L174 (= L176), E178 (= E180)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
41% identity, 89% coverage: 39:361/363 of query aligns to 37:355/357 of 6lk2A
- active site: R121 (= R123), K143 (= K145), E185 (= E187), K227 (= K231), R238 (= R245), N242 (= N249), H245 (= H252), H249 (= H256), H262 (= H269)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D139), E185 (= E187), K227 (= K231), R238 (= R245), N242 (= N249), H245 (= H252), T246 (= T253), H249 (= H256), H262 (= H269)
- binding magnesium ion: E185 (= E187), H245 (= H252), H262 (= H269)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V48), D72 (= D74), E74 (= E76), K77 (= K79), G105 (= G107), G106 (= G108), V107 (= V109), D110 (= D112), T130 (≠ S132), T131 (= T133), L133 (≠ V135), D137 (= D139), S138 (= S140), C170 (≠ L172), T173 (= T175), L174 (= L176), P175 (= P177), E178 (= E180)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
36% identity, 88% coverage: 42:361/363 of query aligns to 31:340/343 of P56081
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
35% identity, 88% coverage: 32:349/363 of query aligns to 29:345/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
37% identity, 78% coverage: 32:315/363 of query aligns to 32:310/354 of 5hvnA
- active site: R123 (= R123), K145 (= K145), E187 (= E187), K228 (= K231), R239 (= R245), N243 (= N249), H246 (= H252), H250 (= H256), H263 (= H269)
- binding nicotinamide-adenine-dinucleotide: N45 (= N45), L51 (= L51), D73 (= D74), E75 (= E76), K78 (= K79), G107 (= G107), G108 (= G108), V109 (= V109), D112 (= D112), T132 (≠ S132), T133 (= T133), L135 (≠ V135), D139 (= D139), K145 (= K145), F172 (≠ L172), T175 (= T175), L176 (= L176), E180 (= E180)
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
35% identity, 79% coverage: 62:349/363 of query aligns to 61:376/391 of 1nvbB
- active site: R128 (= R123), K150 (= K145), E192 (= E187), K248 (= K231), E258 (= E241), R262 (= R245), N266 (= N249), H269 (= H252), H273 (= H256), H285 (= H269)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D139), K150 (= K145), N160 (= N155), E192 (= E187), K248 (= K231), R262 (= R245), L265 (= L248), N266 (= N249), H269 (= H252), H273 (= H256), K354 (= K327)
- binding zinc ion: E192 (= E187), H269 (= H252), H285 (= H269)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
36% identity, 76% coverage: 73:349/363 of query aligns to 78:378/1583 of P07547
Sites not aligning to the query:
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
36% identity, 79% coverage: 62:349/363 of query aligns to 60:368/381 of 1dqsA
- active site: R127 (= R123), K149 (= K145), E191 (= E187), K240 (= K231), E250 (= E241), R254 (= R245), N258 (= N249), H261 (= H252), H265 (= H256), H277 (= H269)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D139), K149 (= K145), N159 (= N155), E191 (= E187), K240 (= K231), R254 (= R245), L257 (= L248), N258 (= N249), H261 (= H252), H265 (= H256), H277 (= H269), K346 (= K327)
- binding nicotinamide-adenine-dinucleotide: E78 (= E76), K81 (= K79), G111 (= G107), G112 (= G108), V113 (= V109), D116 (= D112), T136 (≠ S132), T137 (= T133), L139 (≠ V135), D143 (= D139), S144 (= S140), K158 (= K154), T179 (= T175), P181 (= P177), E184 (= E180), H277 (= H269)
- binding zinc ion: E191 (= E187), H261 (= H252), H277 (= H269)
Sites not aligning to the query:
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
37% identity, 74% coverage: 42:310/363 of query aligns to 28:278/308 of 3clhA
- active site: R107 (= R123), K129 (= K145), E171 (= E187), K207 (= K231), R212 (= R245), N216 (= N249), H219 (= H252), H223 (= H256), H236 (= H269)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ V47), V34 (= V48), H38 (= H52), S58 (≠ D74), E60 (= E76), K63 (= K79), G91 (= G107), G92 (= G108), V93 (= V109), D96 (= D112), T116 (≠ S132), T117 (= T133), L119 (≠ V135), D123 (= D139), A124 (≠ S140), K129 (= K145), N139 (= N155), T159 (= T175), L160 (= L176), E164 (= E180)
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
31% identity, 93% coverage: 11:349/363 of query aligns to 10:336/353 of 1xagA
- active site: R115 (= R123), K136 (= K145), E178 (= E187), K221 (= K231), E231 (= E241), R235 (= R245), N239 (= N249), H242 (= H252), H246 (= H256), H256 (= H269)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K145), N146 (= N155), E178 (= E187), K221 (= K231), R235 (= R245), L238 (= L248), N239 (= N249), H242 (= H252), H246 (= H256), K314 (= K327)
- binding nicotinamide-adenine-dinucleotide: D39 (≠ N45), Y41 (≠ V47), V42 (= V48), Y45 (≠ L51), E68 (= E76), K71 (= K79), G99 (= G107), G100 (= G108), A101 (≠ V109), D104 (= D112), T124 (≠ S132), T125 (= T133), L127 (≠ V135), D130 (= D139), S131 (= S140), K136 (= K145), K145 (= K154), T166 (= T175), L167 (= L176), Q171 (≠ E180), H256 (= H269)
- binding zinc ion: E178 (= E187), H242 (= H252), H256 (= H269)
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
35% identity, 84% coverage: 42:345/363 of query aligns to 39:367/1555 of 6hqvA
- active site: R123 (= R123), K145 (= K145), E187 (= E187), K243 (= K231), E253 (= E241), R257 (= R245), N261 (= N249), H264 (= H252), H268 (= H256), H280 (= H269)
- binding glutamic acid: D139 (= D139), K145 (= K145), E187 (= E187), K243 (= K231), R257 (= R245), H264 (= H252), H280 (= H269)
- binding nicotinamide-adenine-dinucleotide: D42 (≠ N45), N44 (≠ V47), L45 (≠ V48), E76 (= E76), K79 (= K79), G107 (= G107), G108 (= G108), V109 (= V109), D112 (= D112), T132 (≠ S132), T133 (= T133), L135 (≠ V135), D139 (= D139), S140 (= S140), K145 (= K145), K154 (= K154), T175 (= T175), L176 (= L176), P177 (= P177), E180 (= E180), H280 (= H269)
- binding zinc ion: E187 (= E187), H264 (= H252), H280 (= H269)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
37% identity, 82% coverage: 59:356/363 of query aligns to 55:359/385 of 6c5cA
- active site: R130 (= R123), K152 (= K145), E194 (= E187), K246 (vs. gap), E254 (= E241), R258 (= R245), N262 (= N249), H265 (= H252), H269 (= H256), H281 (= H269)
- binding nicotinamide-adenine-dinucleotide: E83 (= E76), K86 (= K79), G114 (= G107), G115 (= G108), V116 (= V109), D119 (= D112), T139 (≠ S132), T140 (= T133), D146 (= D139), S147 (= S140), F179 (≠ L172), T182 (= T175), L183 (= L176), Q187 (≠ E180)
Sites not aligning to the query:
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
30% identity, 93% coverage: 11:349/363 of query aligns to 10:336/354 of Q6GGU4
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
36% identity, 77% coverage: 53:332/363 of query aligns to 52:328/362 of P9WPX9
Sites not aligning to the query:
1nvaA Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp (see paper)
36% identity, 71% coverage: 62:319/363 of query aligns to 60:330/380 of 1nvaA
- active site: R127 (= R123), K149 (= K145), E191 (= E187), K247 (= K231), R257 (= R245), N261 (= N249), H264 (= H252), H268 (= H256), H280 (= H269)
- binding adenosine-5'-diphosphate: G111 (= G107), G112 (= G108), T136 (≠ S132), T137 (= T133), F176 (≠ L172), T179 (= T175), L180 (= L176)
- binding zinc ion: E191 (= E187), H264 (= H252), H280 (= H269)
Sites not aligning to the query:
Query Sequence
>WP_014449654.1 NCBI__GCF_000284315.1:WP_014449654.1
MIRHDVRSRLGDYPVLIESGLLKGLPSLLSGMGWRSEGRVGLITNPVVYPLHGERIVKSL
LSGDFRPETMLLPDGESHKTLGSVSSLLDQLLALRWERREPLLVLGGGVTGDMGGFAASI
LLRGVPVVHIPSTVVAQVDSSVGGKTGVDHSMGKNLIGSFYPPKAVWIDPDLLLTLPLKE
RRAGLGEVIKYAMIGNARLSDLLEKNIQRLGGEKFERDLWSAAISESVFEKSRIVSEDEH
EGGLRMTLNFGHTFGHALEGALGFGGMLHGEAVGLGMLLASRVSERMGLSRGISERLLAL
LKGAGLPYQWPKDVSIEDLKKFWGSDKKTQGGRATIILPVSWGKVLMTRDYDLETVRQSL
SDL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory