SitesBLAST
Comparing WP_014449904.1 NCBI__GCF_000284315.1:WP_014449904.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
36% identity, 82% coverage: 72:421/425 of query aligns to 8:348/350 of 2zsjA
- active site: K61 (= K124), T85 (= T148), Q218 (= Q284), A222 (≠ C288), A240 (≠ S313), T317 (= T390)
- binding pyridoxal-5'-phosphate: F60 (= F123), K61 (= K124), N87 (= N150), V186 (≠ I250), G187 (≠ A251), N188 (≠ S252), A189 (≠ G253), G190 (≠ S254), N191 (≠ L255), A240 (≠ S313), T317 (= T390), G318 (= G391)
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
35% identity, 83% coverage: 70:421/425 of query aligns to 7:347/350 of 6nmxA
- active site: K60 (= K124), T84 (= T148), E216 (≠ Q284), S220 (≠ C288), A238 (≠ S313), T315 (= T390)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K124), S83 (= S147), T84 (= T148), N86 (= N150), T87 (≠ L151), F133 (≠ Y196), N153 (= N216), S154 (≠ N218), R159 (≠ Y223), V185 (≠ I250), G186 (≠ A251), N187 (≠ S252), A188 (≠ G253), G189 (≠ S254), N190 (≠ L255), A238 (≠ S313), I239 (≠ L314), E285 (= E360), T315 (= T390)
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
35% identity, 83% coverage: 70:421/425 of query aligns to 5:345/345 of 6cgqB
- active site: K58 (= K124), T82 (= T148), E214 (≠ Q284), S218 (≠ C288), A236 (≠ S313), T313 (= T390)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K124), S81 (= S147), T82 (= T148), N84 (= N150), T85 (≠ L151), V183 (≠ I250), G184 (≠ A251), N185 (≠ S252), A186 (≠ G253), N188 (≠ L255), A236 (≠ S313), I237 (≠ L314), E283 (= E360), T313 (= T390)
- binding phosphate ion: K58 (= K124), T85 (≠ L151), N151 (= N216), S152 (≠ N218), R157 (≠ Y223), N185 (≠ S252)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
35% identity, 83% coverage: 70:421/425 of query aligns to 3:337/339 of 6cgqA
- active site: K56 (= K124), T80 (= T148), E206 (≠ Q284), S210 (≠ C288), A228 (≠ S313), T305 (= T390)
- binding pyridoxal-5'-phosphate: F55 (= F123), K56 (= K124), N82 (= N150), V175 (≠ I250), G176 (≠ A251), N177 (≠ S252), A178 (≠ G253), G179 (≠ S254), N180 (≠ L255), A228 (≠ S313), E275 (= E360), T305 (= T390), G306 (= G391)
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
36% identity, 80% coverage: 73:413/425 of query aligns to 19:351/360 of A0R220
- K151 (≠ E205) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
37% identity, 77% coverage: 67:395/425 of query aligns to 3:322/351 of 3aexA
- active site: K61 (= K124), T85 (= T148), P212 (= P276), G216 (= G282), Q218 (= Q284), A240 (≠ S313), T317 (= T390)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K124), S84 (= S147), T85 (= T148), N87 (= N150), T88 (≠ L151), V186 (≠ I250), G187 (≠ A251), N188 (≠ S252), A189 (≠ G253), G190 (≠ S254), N191 (≠ L255), A240 (≠ S313), I241 (≠ L314), E287 (= E360), T317 (= T390)
- binding phosphate ion: K61 (= K124), T88 (≠ L151), N154 (= N216), S155 (≠ N218), R160 (≠ Y223), N188 (≠ S252)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
37% identity, 77% coverage: 67:395/425 of query aligns to 3:322/351 of 1v7cA
- active site: K61 (= K124), T85 (= T148), P212 (= P276), G216 (= G282), Q218 (= Q284), A240 (≠ S313), T317 (= T390)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K124), S84 (= S147), T85 (= T148), N87 (= N150), T88 (≠ L151), F134 (≠ Y196), N154 (= N216), S155 (≠ N218), R160 (≠ Y223), V186 (≠ I250), G187 (≠ A251), N188 (≠ S252), A189 (≠ G253), G190 (≠ S254), N191 (≠ L255), A240 (≠ S313), I241 (≠ L314), E287 (= E360), T317 (= T390)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
37% identity, 77% coverage: 67:395/425 of query aligns to 3:322/350 of 1uimA
- active site: K61 (= K124), T85 (= T148), P212 (= P276), G216 (= G282), Q218 (= Q284), A240 (≠ S313), T317 (= T390)
- binding pyridoxal-5'-phosphate: F60 (= F123), K61 (= K124), N87 (= N150), G187 (≠ A251), N188 (≠ S252), A189 (≠ G253), G190 (≠ S254), N191 (≠ L255), A240 (≠ S313), E287 (= E360), T317 (= T390), G318 (= G391)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
37% identity, 77% coverage: 67:395/425 of query aligns to 2:321/350 of 3aeyA
- active site: K60 (= K124), T84 (= T148), P211 (= P276), G215 (= G282), Q217 (= Q284), A239 (≠ S313), T316 (= T390)
- binding sulfate ion: K60 (= K124), K60 (= K124), G85 (= G149), N86 (= N150), T87 (≠ L151), T87 (≠ L151), S154 (≠ N218), R159 (≠ Y223), N187 (≠ S252), R228 (≠ K299), V230 (= V305), E231 (vs. gap), R232 (= R306), A239 (≠ S313)
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
35% identity, 76% coverage: 73:395/425 of query aligns to 10:322/349 of 2d1fA
- active site: K60 (= K124), T84 (= T148), D209 (= D273), R213 (≠ K279), L215 (≠ N281), A240 (≠ S313), T317 (= T390)
- binding pyridoxal-5'-phosphate: F59 (= F123), K60 (= K124), N86 (= N150), V186 (≠ I250), G187 (≠ A251), N188 (≠ S252), A189 (≠ G253), G190 (≠ S254), N191 (≠ L255), A240 (≠ S313), T317 (= T390)
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 76% coverage: 73:395/425 of query aligns to 19:331/360 of P9WG59
- K69 (= K124) modified: N6-(pyridoxal phosphate)lysine
- N95 (= N150) binding
- K151 (≠ E205) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (≠ ASGSL 251:255) binding
- T326 (= T390) binding
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
31% identity, 84% coverage: 43:399/425 of query aligns to 34:406/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F123), K128 (= K124), D159 (≠ N150), G259 (≠ I250), G260 (≠ A251), N261 (≠ S252), L262 (≠ G253), G263 (≠ S254), N264 (≠ L255), A321 (≠ S313), H369 (≠ A362), T397 (= T390)
- binding s-adenosylmethionine: S64 (≠ K61), T65 (≠ S62), W66 (≠ I63), P67 (≠ E64), G69 (= G66), S90 (≠ G86), F92 (≠ H88), N97 (≠ P93), L98 (= L94), W100 (≠ R96), W115 (≠ Y110), W115 (≠ Y110), Q246 (= Q237), F247 (≠ L238)
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 84% coverage: 43:399/425 of query aligns to 109:481/526 of Q9S7B5
- N172 (≠ P93) binding
- L173 (= L94) binding
- K181 (≠ R102) binding in monomer B; binding in monomer A
- N187 (≠ K107) binding in monomer B
- L205 (vs. gap) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
31% identity, 84% coverage: 43:399/425 of query aligns to 52:408/448 of 2c2gA
6zspAAA serine racemase bound to atp and malonate. (see paper)
24% identity, 66% coverage: 91:370/425 of query aligns to 22:283/320 of 6zspAAA
- active site: K53 (= K124), S74 (≠ T148), E200 (≠ Q284), A204 (≠ C288), D206 (≠ P290), G229 (≠ S313)
- binding adenosine-5'-triphosphate: S28 (≠ A97), S29 (≠ D98), I30 (≠ R99), K48 (≠ H118), T49 (= T120), Q79 (≠ N153), Y111 (= Y185), E266 (= E353), R267 (≠ T354), K269 (≠ G356)
- binding magnesium ion: E200 (≠ Q284), A204 (≠ C288), D206 (≠ P290)
- binding malonate ion: K53 (= K124), S73 (= S147), S74 (≠ T148), N76 (= N150), H77 (≠ L151), R125 (≠ V199), G229 (≠ S313), S232 (≠ P319)
Sites not aligning to the query:
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
23% identity, 66% coverage: 91:370/425 of query aligns to 22:285/310 of 7nbgDDD
- active site: K53 (= K124), S76 (≠ T148), E202 (≠ Q284), A206 (≠ C288), D208 (≠ P290), G231 (≠ S313)
- binding calcium ion: E202 (≠ Q284), A206 (≠ C288), D208 (≠ P290)
- binding magnesium ion: N239 (≠ Y324)
- binding ortho-xylene: S76 (≠ T148), Q81 (≠ N153), I96 (≠ V168), Y113 (= Y185)
- binding pyridoxal-5'-phosphate: F52 (= F123), K53 (= K124), N78 (= N150), G177 (≠ A251), G178 (≠ S252), G179 (= G253), G180 (≠ S254), M181 (≠ L255), G231 (≠ S313), V232 (≠ L314), E275 (= E360), T277 (≠ A362)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
23% identity, 66% coverage: 91:370/425 of query aligns to 23:286/322 of 3l6bA
- active site: K54 (= K124), S77 (≠ T148), E203 (≠ Q284), A207 (≠ C288), D209 (≠ P290), G232 (≠ S313), T278 (≠ A362)
- binding malonate ion: K54 (= K124), S76 (= S147), S77 (≠ T148), N79 (= N150), H80 (≠ L151), R128 (≠ V199), G232 (≠ S313)
- binding manganese (ii) ion: E203 (≠ Q284), A207 (≠ C288), D209 (≠ P290)
- binding pyridoxal-5'-phosphate: F53 (= F123), K54 (= K124), N79 (= N150), G178 (≠ A251), G179 (≠ S252), G180 (= G253), G181 (≠ S254), M182 (≠ L255), V233 (≠ L314), E276 (= E360), T278 (≠ A362)
Sites not aligning to the query:
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
23% identity, 66% coverage: 91:370/425 of query aligns to 22:290/320 of 7nbhAAA
- active site: K53 (= K124), S81 (≠ T148), E207 (≠ Q284), A211 (≠ C288), D213 (≠ P290), G236 (≠ S313)
- binding calcium ion: E207 (≠ Q284), A211 (≠ C288), D213 (≠ P290)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ T148), G85 (≠ A152), Q86 (≠ N153), K111 (= K178), I115 (≠ N182), Y118 (= Y185), D235 (≠ K312), P281 (≠ T361)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
23% identity, 66% coverage: 91:370/425 of query aligns to 22:290/322 of 7nbgAAA
- active site: K53 (= K124), S81 (≠ T148), E207 (≠ Q284), A211 (≠ C288), D213 (≠ P290), G236 (≠ S313)
- binding calcium ion: E207 (≠ Q284), A211 (≠ C288), D213 (≠ P290)
- binding pyridoxal-5'-phosphate: F52 (= F123), K53 (= K124), N83 (= N150), G182 (≠ A251), G183 (≠ S252), G184 (= G253), G185 (≠ S254), M186 (≠ L255), G236 (≠ S313), V237 (≠ L314), T282 (≠ A362)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ T148), G85 (≠ A152), Q86 (≠ N153), I101 (≠ V168), K111 (= K178), I115 (≠ N182), Y118 (= Y185)
Sites not aligning to the query:
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
23% identity, 66% coverage: 91:370/425 of query aligns to 22:290/323 of 7nbfAAA
- active site: K53 (= K124), S81 (≠ T148), E207 (≠ Q284), A211 (≠ C288), D213 (≠ P290), G236 (≠ S313)
- binding calcium ion: E207 (≠ Q284), A211 (≠ C288), D213 (≠ P290)
- binding magnesium ion: N244 (≠ Y324)
- binding pyridoxal-5'-phosphate: F52 (= F123), K53 (= K124), N83 (= N150), G182 (≠ A251), G183 (≠ S252), G184 (= G253), G185 (≠ S254), M186 (≠ L255), G236 (≠ S313), V237 (≠ L314), T282 (≠ A362)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: L22 (≠ M91), T23 (= T92), P24 (= P93), L26 (≠ V95), T27 (≠ R96), F46 (≠ V116)
Sites not aligning to the query:
Query Sequence
>WP_014449904.1 NCBI__GCF_000284315.1:WP_014449904.1
MSNPSVPIQSDPSAHSGVKALKCRECGRRYELLAIHVCEFCFGPLEVEYDYEVIGRKISR
KSIEAGPVSLWRYKDLLPVLGEPTAGLHAGMTPLVRADRLGRALGLKNLYVKNDTVNHPT
LSFKDRVVAVATTRARELGFTTIACASTGNLANSVSAHAASCGMECFVFIPHDLEAGKVL
GNLIYKPTVVSVKGTYDDVNRLCSEIGAEYPWAFVNINIRPYYAEGSKSLAFETAEQLGW
RVPDQVVVPIASGSLLTKIWKGFHEFTRLGLVDENPLLKVNGAQASGCSPVYQAYVSGKN
HIVPVRPNTIAKSLAIGNPADGFYALDVVGKSGGQVEQATDSEIIDGMKLLAETEGIFAE
TAGGVTVACLKKLAEKGAIRPDELTVAYITGNGLKTMEALAGSLSQPVSIDPNLSSFRQI
VNPKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory