Comparing WP_015738236.1 NCBI__GCF_000024605.1:WP_015738236.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
48% identity, 97% coverage: 9:370/373 of query aligns to 2:363/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
47% identity, 98% coverage: 6:370/373 of query aligns to 1:365/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
43% identity, 96% coverage: 12:370/373 of query aligns to 5:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
43% identity, 96% coverage: 12:370/373 of query aligns to 5:321/323 of 2j5vA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
35% identity, 69% coverage: 3:260/373 of query aligns to 6:256/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
38% identity, 61% coverage: 3:231/373 of query aligns to 6:228/236 of 7f5xA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
35% identity, 68% coverage: 10:261/373 of query aligns to 1:240/241 of 2akoA
8j0gB Gk monomer complexes with glutamate and atp
37% identity, 68% coverage: 7:260/373 of query aligns to 5:267/274 of 8j0gB
8j0eB Gk monomer complexes with catalytic intermediate
36% identity, 68% coverage: 7:260/373 of query aligns to 8:262/269 of 8j0eB
8j0fA Gk tetramer with adjacent hooks at reaction state
36% identity, 68% coverage: 7:260/373 of query aligns to 9:261/270 of 8j0fA
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
35% identity, 29% coverage: 154:262/373 of query aligns to 121:226/226 of 2bmuB
Sites not aligning to the query:
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
35% identity, 29% coverage: 154:262/373 of query aligns to 120:225/225 of Q8U122
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
32% identity, 29% coverage: 154:262/373 of query aligns to 122:219/219 of 2ji5A
Sites not aligning to the query:
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
36% identity, 27% coverage: 155:256/373 of query aligns to 151:248/253 of 7n9dA
Sites not aligning to the query:
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
36% identity, 27% coverage: 155:256/373 of query aligns to 152:251/260 of 7lntB
Sites not aligning to the query:
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
35% identity, 27% coverage: 155:256/373 of query aligns to 153:252/261 of 7lnuB
Sites not aligning to the query:
O60163 Probable aspartokinase; Aspartate kinase; EC 2.7.2.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 23% coverage: 146:231/373 of query aligns to 220:302/519 of O60163
Sites not aligning to the query:
3ll9B X-ray structures of isopentenyl phosphate kinase (see paper)
28% identity, 38% coverage: 114:256/373 of query aligns to 114:243/249 of 3ll9B
Sites not aligning to the query:
7lnwA I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
32% identity, 27% coverage: 155:256/373 of query aligns to 151:247/256 of 7lnwA
Sites not aligning to the query:
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
30% identity, 23% coverage: 107:193/373 of query aligns to 157:248/468 of 3c1mC
Sites not aligning to the query:
>WP_015738236.1 NCBI__GCF_000024605.1:WP_015738236.1
MRREEFKHCRRLVVKVGTSSITLPSGELNLEQIAKLVDELAAVHREGKEVLLVSSGAIGA
GMGRLGLRSRPRTIPEKQACAAVGQGLLMQIYERFFSSHGITVGQVLLTRDDFAHRRRFL
NARNTLLTLLEYRVVPIINENDTVAVEEIRLGDNDTLSALVASLINAELLLILSDVDGLY
TGDPRRDPQARLISEVKELTPEIWALAGGPGSQVGSGGMLTKLEAARIAGRSGCTLVIAR
ASLPGVIRRVLAGEEIGTVFFPREKLREKRRWLLFGAQVKGKIYVDAGAAKALREGGKSL
LPSGIVGVEGNFEAGHAVSIVDPEGKEIARGLVNYSAAEVEQIKGCKTCEIEAVLGSRLY
DEVVHRDNLVLQE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory