SitesBLAST
Comparing WP_015738271.1 NCBI__GCF_000024605.1:WP_015738271.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
51% identity, 98% coverage: 5:544/552 of query aligns to 93:648/664 of P09114
- P191 (= P102) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W472) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
50% identity, 98% coverage: 5:544/552 of query aligns to 96:651/667 of P09342
- C161 (= C69) modified: Disulfide link with 307
- P194 (= P102) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V213) modified: Disulfide link with 161
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 13:575/582 of 3ea4A
- active site: Y32 (= Y24), G34 (= G26), G35 (= G27), A36 (= A28), S37 (≠ V29), E58 (= E49), T81 (= T72), F120 (= F111), Q121 (= Q112), E122 (= E113), K170 (≠ R161), M265 (= M256), V292 (≠ I283), V399 (= V383), G425 (= G409), M427 (= M411), D452 (= D436), N479 (= N463), H481 (≠ F465), L482 (= L466), M484 (= M468), V485 (= V469), W488 (= W472), H557 (≠ R533)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D281), R291 (= R282), W488 (= W472), S567 (≠ P543)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R151), G221 (= G210), G222 (= G211), G223 (= G212), T245 (= T236), L246 (= L237), M247 (= M238), L263 (= L254), G264 (= G255), M265 (= M256), H266 (= H257), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (= I301), G327 (= G318), D328 (= D319), V329 (≠ L320), M404 (= M388), G422 (= G406)
- binding magnesium ion: D452 (= D436), N479 (= N463), H481 (≠ F465)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V383), G400 (= G384), Q401 (= Q385), H402 (≠ N386), M427 (= M411), G451 (= G435), D452 (= D436), G453 (= G437), S454 (= S438), N479 (= N463), H481 (≠ F465), L482 (= L466), G483 (= G467), M484 (= M468), V485 (= V469)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 13:575/582 of 3e9yA
- active site: Y32 (= Y24), G34 (= G26), G35 (= G27), A36 (= A28), S37 (≠ V29), E58 (= E49), T81 (= T72), F120 (= F111), Q121 (= Q112), E122 (= E113), K170 (≠ R161), M265 (= M256), V292 (≠ I283), V399 (= V383), G425 (= G409), M427 (= M411), D452 (= D436), N479 (= N463), H481 (≠ F465), L482 (= L466), M484 (= M468), V485 (= V469), W488 (= W472), H557 (≠ R533)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D281), R291 (= R282), W488 (= W472), S567 (≠ P543)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R151), G221 (= G210), G222 (= G211), G223 (= G212), T245 (= T236), L246 (= L237), M247 (= M238), L263 (= L254), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (= I301), G327 (= G318), D328 (= D319), V329 (≠ L320), M404 (= M388), G422 (= G406)
- binding magnesium ion: D452 (= D436), N479 (= N463), H481 (≠ F465)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V383), G400 (= G384), Q401 (= Q385), H402 (≠ N386), M427 (= M411), G451 (= G435), G453 (= G437), S454 (= S438), N479 (= N463), H481 (≠ F465), L482 (= L466), G483 (= G467), M484 (= M468), V485 (= V469)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V383), G401 (= G384), Q402 (= Q385), H403 (≠ N386), G426 (= G409), M428 (= M411), G452 (= G435), D453 (= D436), G454 (= G437), S455 (= S438), M458 (= M441), N480 (= N463), H482 (≠ F465), L483 (= L466), G484 (= G467), M485 (= M468), V486 (= V469)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ T277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M388), G423 (= G406)
- binding magnesium ion: F370 (= F354), D453 (= D436), M458 (= M441), Q461 (= Q444), N480 (= N463), H482 (≠ F465), K533 (≠ P508)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M256), R292 (= R282), M485 (= M468), W489 (= W472), S568 (≠ P543)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 5wj1A
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), M263 (= M253), L264 (= L254), G286 (= G276), R288 (= R278), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M388), G423 (= G406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M256), D291 (= D281), R292 (= R282), M485 (= M468), W489 (= W472), S568 (≠ P543)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V383), G401 (= G384), Q402 (= Q385), H403 (≠ N386), M428 (= M411), D453 (= D436), G454 (= G437), S455 (= S438), M458 (= M441), N480 (= N463), H482 (≠ F465), L483 (= L466), G484 (= G467), M485 (= M468), V486 (= V469)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 5k6tA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H257), R292 (= R282), M485 (= M468), W489 (= W472), S568 (≠ P543)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G286 (= G276), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q387), M405 (= M388), G423 (= G406)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V383), G401 (= G384), Q402 (= Q385), H403 (≠ N386), G426 (= G409), M428 (= M411), G452 (= G435), G454 (= G437), S455 (= S438), N480 (= N463), H482 (≠ F465), L483 (= L466), G484 (= G467)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 5k6rA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R282), W489 (= W472), S568 (≠ P543)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), G286 (= G276), R288 (= R278), R292 (= R282), V293 (≠ I283), D310 (= D300), I311 (= I301), G328 (= G318), D329 (= D319), V330 (≠ L320), M405 (= M388), G423 (= G406)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V383), G401 (= G384), Q402 (= Q385), H403 (≠ N386), G426 (= G409), M428 (= M411), D453 (= D436), G454 (= G437), S455 (= S438), M458 (= M441), N480 (= N463), H482 (≠ F465), L483 (= L466), G484 (= G467), M485 (= M468), V486 (= V469)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 1z8nA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K125), R161 (= R151), Y191 (= Y181), R194 (= R182), D291 (= D281), R292 (= R282), D312 (= D302), W489 (= W472), G569 (= G544)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ T277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M388), G423 (= G406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N463)
- binding thiamine diphosphate: V400 (= V383), G401 (= G384), Q402 (= Q385), H403 (≠ N386), G426 (= G409), M428 (= M411), G452 (= G435), G454 (= G437), S455 (= S438), N480 (= N463), H482 (≠ F465), L483 (= L466), G484 (= G467), M485 (= M468), V486 (= V469)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 1yi1A
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D281), R292 (= R282), W489 (= W472), S568 (≠ P543)
- binding flavin-adenine dinucleotide: R161 (= R151), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), M263 (= M253), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ T277), R288 (= R278), D290 (= D280), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M388), G423 (= G406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 1yi0A
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), W489 (= W472), S568 (≠ P543)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ T277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ I283), D310 (= D300), I311 (= I301), G328 (= G318), D329 (= D319), V330 (≠ L320), M405 (= M388), G423 (= G406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 1yhzA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D281), R292 (= R282), M485 (= M468), W489 (= W472), S568 (≠ P543)
- binding flavin-adenine dinucleotide: R161 (= R151), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ T277), R288 (= R278), D290 (= D280), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q387), M405 (= M388), G423 (= G406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 1yhyA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), V486 (= V469), W489 (= W472), S568 (≠ P543)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ T277), R288 (= R278), D290 (= D280), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q387), M405 (= M388), G423 (= G406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 1ybhA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M256), D291 (= D281), R292 (= R282), M485 (= M468), W489 (= W472), S568 (≠ P543)
- binding flavin-adenine dinucleotide: R161 (= R151), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ T277), R288 (= R278), D290 (= D280), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q387), M405 (= M388), G423 (= G406), G424 (= G407)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
48% identity, 99% coverage: 5:551/552 of query aligns to 99:661/670 of P17597
- A122 (= A28) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L30) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E49) binding
- S186 (= S91) binding
- P197 (= P102) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ S104) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q112) binding
- K220 (= K125) binding
- R246 (= R151) binding ; binding
- K256 (≠ R161) binding
- G308 (= G211) binding
- TL 331:332 (= TL 236:237) binding
- C340 (≠ G245) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 254:257) binding
- GVRFD 371:375 (≠ GTRLD 276:280) binding
- DR 376:377 (= DR 281:282) binding
- DI 395:396 (= DI 300:301) binding
- DV 414:415 (≠ DL 319:320) binding
- QH 487:488 (≠ QN 385:386) binding
- GG 508:509 (= GG 406:407) binding
- GAM 511:513 (≠ GTM 409:411) binding
- D538 (= D436) binding
- DGS 538:540 (= DGS 436:438) binding
- N565 (= N463) binding
- NQHLGM 565:570 (≠ NGFLGM 463:468) binding
- H567 (≠ F465) binding
- W574 (= W472) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P543) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/583 of 5k3sA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R282), M485 (= M468), W489 (= W472), G569 (= G544)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), M266 (= M256), G286 (= G276), R288 (= R278), D290 (= D280), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M388), G423 (= G406)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V383), G401 (= G384), Q402 (= Q385), H403 (≠ N386), G426 (= G409), M428 (= M411), D453 (= D436), G454 (= G437), S455 (= S438), N480 (= N463), H482 (≠ F465), L483 (= L466), G484 (= G467), M485 (= M468), V486 (= V469)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/585 of 5k2oA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (≠ R161), M266 (= M256), V293 (≠ I283), V400 (= V383), G426 (= G409), M428 (= M411), D453 (= D436), N480 (= N463), H482 (≠ F465), L483 (= L466), M485 (= M468), V486 (= V469), W489 (= W472), H558 (≠ R533)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M256), R292 (= R282), W489 (= W472), S568 (≠ P543)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (= L254), G286 (= G276), R288 (= R278), D290 (= D280), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q387), M405 (= M388), G423 (= G406)
- binding magnesium ion: D453 (= D436), N480 (= N463), H482 (≠ F465)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V383), G401 (= G384), Q402 (= Q385), H403 (≠ N386), M428 (= M411), D453 (= D436), G454 (= G437), S455 (= S438), N480 (= N463), H482 (≠ F465), L483 (= L466), G484 (= G467), M485 (= M468), V486 (= V469)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
48% identity, 99% coverage: 5:551/552 of query aligns to 14:576/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M256), R292 (= R282), W489 (= W472), S568 (≠ P543)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V383), G401 (= G384), Q402 (= Q385), H403 (≠ N386), G426 (= G409), M428 (= M411), G452 (= G435), D453 (= D436), G454 (= G437), S455 (= S438), L483 (= L466), G484 (= G467), M485 (= M468), V486 (= V469)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), M263 (= M253), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), R288 (= R278), V293 (≠ I283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M388), G423 (= G406)
- binding magnesium ion: A37 (= A28), T82 (= T72), S83 (= S73), Q122 (= Q112), Y381 (≠ F364), D453 (= D436), M458 (= M441), Q461 (= Q444), N480 (= N463), H482 (≠ F465), K533 (≠ P508)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
46% identity, 99% coverage: 3:551/552 of query aligns to 14:579/601 of 6deqA
- active site: Y35 (= Y24), G37 (= G26), G38 (= G27), A39 (= A28), I40 (≠ V29), E61 (= E49), T84 (= T72), F123 (= F111), Q124 (= Q112), E125 (= E113), K173 (≠ R161), K232 (≠ E221), M268 (= M256), V295 (≠ I283), V411 (= V383), L436 (= L408), G437 (= G409), M439 (= M411), D464 (= D436), N491 (= N463), E493 (≠ F465), Q494 (≠ L466), M496 (= M468), V497 (= V469), W500 (= W472), L522 (≠ V494), N527 (≠ G499), V528 (≠ A500)
- binding flavin-adenine dinucleotide: R163 (= R151), G221 (= G210), A222 (≠ G211), G223 (= G212), N226 (≠ Q215), T248 (= T236), L249 (= L237), Q250 (≠ M238), L266 (= L254), G288 (= G276), A289 (≠ T277), R290 (= R278), D292 (= D280), R294 (= R282), V295 (≠ I283), E321 (≠ D300), I322 (= I301), D340 (= D319), V341 (≠ L320), M416 (= M388), G434 (= G406)
- binding magnesium ion: D464 (= D436), N491 (= N463), E493 (≠ F465)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (= M256), R294 (= R282), M496 (= M468), V497 (= V469), W500 (= W472), A571 (≠ P543)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V383), G412 (= G384), Q413 (= Q385), H414 (≠ N386), M439 (= M411), G463 (= G435), D464 (= D436), A465 (≠ G437), S466 (= S438), N491 (= N463), E493 (≠ F465), Q494 (≠ L466), G495 (= G467), M496 (= M468), V497 (= V469)
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
46% identity, 99% coverage: 3:551/552 of query aligns to 14:577/599 of 6denA
- active site: Y35 (= Y24), G37 (= G26), G38 (= G27), A39 (= A28), I40 (≠ V29), E61 (= E49), T84 (= T72), F123 (= F111), Q124 (= Q112), E125 (= E113), K173 (≠ R161), K230 (≠ E221), M266 (= M256), V293 (≠ I283), V409 (= V383), L434 (= L408), G435 (= G409), M437 (= M411), D462 (= D436), N489 (= N463), E491 (≠ F465), Q492 (≠ L466), M494 (= M468), V495 (= V469), W498 (= W472), L520 (≠ V494), N525 (≠ G499), V526 (≠ A500)
- binding flavin-adenine dinucleotide: R163 (= R151), G219 (= G210), A220 (≠ G211), G221 (= G212), N224 (≠ Q215), T246 (= T236), L247 (= L237), Q248 (≠ M238), L264 (= L254), G286 (= G276), A287 (≠ T277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ I283), E319 (≠ D300), I320 (= I301), N324 (≠ E305), D338 (= D319), V339 (≠ L320), M414 (= M388), G432 (= G406)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (= M256), D291 (= D281), R292 (= R282), W498 (= W472)
- binding magnesium ion: D462 (= D436), N489 (= N463), E491 (≠ F465)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (= V383), G410 (= G384), Q411 (= Q385), H412 (≠ N386), G435 (= G409), M437 (= M411), G461 (= G435), D462 (= D436), A463 (≠ G437), S464 (= S438), N489 (= N463), E491 (≠ F465), Q492 (≠ L466), G493 (= G467), M494 (= M468), V495 (= V469)
Query Sequence
>WP_015738271.1 NCBI__GCF_000024605.1:WP_015738271.1
MRLTGGEILLKCLQEEGVEVVFGYPGGAVLPIYDALYEGEIRHILTRHEQAAAHAADGYA
RATGRPGVCLATSGPGATNLVTGIATAYMDSSPVVAFTGQVPTSLIGRDAFQEADITGIT
MPITKHNFLVKDVKDLARVVKAAFHIATTGRPGPVLVDIPRDVSGAETEYEPVTEVRLPG
YRPVYDPDPEQIKKAAKLIATSERPVIIAGGGVIQSGATEELVRLAELIMAPVATTLMGI
GGFPGNHPLSLGMLGMHGTRYANYAVSESDLLIAVGTRLDDRITGKIESFAPEAKVIHID
IDPAELGKNVRVDVPIVGDLKRALKALIEFLEKTPHPAWLEKIETWKREYPLTFEENGRL
KPQFIVRQIWEVTKGEARIATEVGQNQMWAAQFYTFTRPRSFITSGGLGTMGFGFPAAIG
VQVACPEEVVFDIAGDGSIQMNIQELATAVSYDLPVNVAILNNGFLGMVRQWQELFYRRR
YSYTELYNPDFVKVAEAYGAEGIRVTKPEEVRPALEQAIASPKPVFLDFIIEREENVMPM
VPPGESIGKMLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory