Comparing WP_015738377.1 NCBI__GCF_000024605.1:WP_015738377.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3zyyX Reductive activator for corrinoid,iron-sulfur protein (see paper)
50% identity, 99% coverage: 3:619/622 of query aligns to 3:628/628 of 3zyyX
4c1nI Corrinoid protein reactivation complex with activator (see paper)
54% identity, 82% coverage: 111:619/622 of query aligns to 2:509/509 of 4c1nI
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
37% identity, 16% coverage: 10:111/622 of query aligns to 9:107/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
37% identity, 16% coverage: 10:111/622 of query aligns to 8:106/333 of 5ogxA
Sites not aligning to the query:
1frrA Crystal structure of [2fe-2s] ferredoxin i from equisetum arvense at 1.8 angstroms resolution (see paper)
37% identity, 13% coverage: 8:85/622 of query aligns to 9:86/95 of 1frrA
3ah7A Crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004
42% identity, 8% coverage: 1:52/622 of query aligns to 7:58/109 of 3ah7A
Sites not aligning to the query:
1i7hA Crystal sturcuture of fdx (see paper)
29% identity, 15% coverage: 1:92/622 of query aligns to 6:104/109 of 1i7hA
>WP_015738377.1 NCBI__GCF_000024605.1:WP_015738377.1
MPRVRFLPEGITVEVPLGNTLLQAAARAGIVLEGACGGEGVCGRCRVQVQEGKVTSPPNP
RLSLQERQEGWVLACQAVPEGEVAVFVPESSVFTAHRVLKAEESLTLQTKEPLWWEEKLT
LPPPTLEDNTDDWGRLSWALQQRGIAPLWPSRHLLAELPRTLRAADWQVKVELAFLDKAL
YELQGIKPAGRGEGTWGVAVDLGTTTVAAELVDLATGQVVATAGTYNRQAAFGDDVISRI
VYATETPRGREELQQAILETVNGLIDELCREAGISFKDIRAVVGAGNTTMVHLLLNLDPT
YIRLEPYVPAANAPPPVKAAKLGLKAHPEAWVYLVPGVASYVGGDVVAGVKVTGVGEEEE
LTLFLDIGTNGEMVLGNREWLMACACSAGPAFEGSGITCGMRAVAGAIEEVEVSPGGEEV
FYRTVDGKKPLGICGSGLISLLSSLLRAGVIDRSGRFVEGLDTPRLREGEEGKEFVLVWG
ESTGHGRDIYVTQGDLQNLLRAKAAIFAGLRTLLSLVGLEAASLERVYIAGGFGRFIDVE
DAIGIGMLPDLPRERYAYVGNTSLKGARLCLLSRRAWQETAELARRITYVELSVGNLFME
EFMAALFLPHTNADLFPSVKGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory