Comparing WP_015739145.1 NCBI__GCF_000024605.1:WP_015739145.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
39% identity, 96% coverage: 1:351/367 of query aligns to 8:358/373 of 5uyyA
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
39% identity, 95% coverage: 4:351/367 of query aligns to 3:350/365 of 6u60B
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
36% identity, 77% coverage: 2:283/367 of query aligns to 5:285/285 of 3ggoA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
36% identity, 77% coverage: 2:283/367 of query aligns to 13:293/293 of 3gggD
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
36% identity, 77% coverage: 2:283/367 of query aligns to 5:285/286 of 3ggpA
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
37% identity, 76% coverage: 5:283/367 of query aligns to 7:286/293 of 4wjiA
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
36% identity, 76% coverage: 5:283/367 of query aligns to 9:285/286 of 3b1fA
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
38% identity, 70% coverage: 4:261/367 of query aligns to 2:252/279 of 2f1kA
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
24% identity, 80% coverage: 4:298/367 of query aligns to 11:277/280 of 2pv7B
>WP_015739145.1 NCBI__GCF_000024605.1:WP_015739145.1
MLGKVVIVGVGLIGGSLGLALRRRGKAREVVGIGRSAERLRQAQALGAVDSFTTDLAEGV
RGADLVVVATPIGIIVPTMHALAPHLEPGTVVTDVGSTKREIVEAAERLAAKHSFAFVGG
HPMAGSERTGVENADPYLFENAYYILTPTPKTPPEAISRVAELVEAVGARKVEIPPDLHD
YYVAAVSHLPHCLASALCNLIASLPEKEAILPLAAGGFRDTTRVAAGDPVLWRDILLTNT
APLRELLALLLRVLQELEELLAKKDARGLEEWLRRAQILRKEVPTKSKGYLPELHEIVVT
VPDRPGVIAHLASLLAEKEINIADIEILRAREGEGGTIRLAFTRPEAQEKAYETLAAAGI
EVRKRGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory